Godeps/

Package sdk is the official AWS SDK for the Go programming language.

Package aws provides the core SDK's utilities and shared types.

Package awserr represents API error interface accessors for the SDK.

Package credentials provides credential retrieval and management

Package endpointcreds provides support for retrieving credentials from an arbitrary HTTP endpoint.

Package plugincreds implements a credentials provider sourced from a Go plugin.

Package stscreds are credential Providers to retrieve STS AWS credentials.

Package defaults is a collection of helpers to retrieve the SDK's default configuration and handlers.

Package ec2metadata provides the client for making API calls to the EC2 Metadata service.

Package endpoints provides the types and functionality for defining regions and endpoints, as well as querying those definitions.

Package session provides configuration for the SDK's service clients.

Package v4 implements signing for AWS V4 signer

Package unit performs initialization and validation for unit tests

Package endpoints contains the models for endpoints that should be used to generate endpoint definition files for the SDK.

Package ec2query provides serialization of AWS EC2 requests and responses.

Package jsonutil provides JSON serialization of AWS requests and responses.

Package jsonrpc provides JSON RPC utilities for serialization of AWS requests and responses.

Package query provides serialization of AWS query requests, and responses.

Package rest provides RESTful serialization of AWS requests and responses.

Package restjson provides RESTful JSON serialization of AWS requests and responses.

Package restxml provides RESTful XML serialization of AWS requests and responses.

Package xmlutil provides XML serialization of AWS requests and responses.

Package service contains automatically generated AWS clients.

Package acm provides the client and types for making API requests to AWS Certificate Manager.

Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.

Package apigateway provides the client and types for making API requests to Amazon API Gateway.

Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.

Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.

Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.

Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.

Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.

Package appstream provides the client and types for making API requests to Amazon AppStream.

Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.

Package athena provides the client and types for making API requests to Amazon Athena.

Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.

Package autoscaling provides the client and types for making API requests to Auto Scaling.

Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.

Package batch provides the client and types for making API requests to AWS Batch.

Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.

Package budgets provides the client and types for making API requests to AWS Budgets.

Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.

Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.

Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.

Package cloudformation provides the client and types for making API requests to AWS CloudFormation.

Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.

Package cloudfront provides the client and types for making API requests to Amazon CloudFront.

Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.

Package sign provides utilities to generate signed URLs for Amazon CloudFront.

Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM.

Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.

Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.

Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.

Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.

Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.

Package cloudtrail provides the client and types for making API requests to AWS CloudTrail.

Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.

Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch.

Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.

Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.

Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.

Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.

Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.

Package codebuild provides the client and types for making API requests to AWS CodeBuild.

Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.

Package codecommit provides the client and types for making API requests to AWS CodeCommit.

Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.

Package codedeploy provides the client and types for making API requests to AWS CodeDeploy.

Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.

Package codepipeline provides the client and types for making API requests to AWS CodePipeline.

Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.

Package codestar provides the client and types for making API requests to AWS CodeStar.

Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.

Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.

Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.

Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.

Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.

Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.

Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.

Package configservice provides the client and types for making API requests to AWS Config.

Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.

Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.

Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.

Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.

Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.

Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.

Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.

Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX).

Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.

Package devicefarm provides the client and types for making API requests to AWS Device Farm.

Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.

Package directconnect provides the client and types for making API requests to AWS Direct Connect.

Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.

Package directoryservice provides the client and types for making API requests to AWS Directory Service.

Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.

Package dynamodb provides the client and types for making API requests to Amazon DynamoDB.

Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.

Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.

Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.

Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.

Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud.

Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.

Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry.

Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.

Package ecs provides the client and types for making API requests to Amazon EC2 Container Service.

Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.

Package efs provides the client and types for making API requests to Amazon Elastic File System.

Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.

Package elasticache provides the client and types for making API requests to Amazon ElastiCache.

Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.

Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk.

Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.

Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.

Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.

Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.

Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.

Package elb provides the client and types for making API requests to Elastic Load Balancing.

Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.

Package elbv2 provides the client and types for making API requests to Elastic Load Balancing.

Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.

Package emr provides the client and types for making API requests to Amazon Elastic MapReduce.

Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.

Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose.

Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.

Package gamelift provides the client and types for making API requests to Amazon GameLift.

Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.

Package glacier provides the client and types for making API requests to Amazon Glacier.

Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.

Package greengrass provides the client and types for making API requests to AWS Greengrass.

Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.

Package health provides the client and types for making API requests to AWS Health APIs and Notifications.

Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.

Package iam provides the client and types for making API requests to AWS Identity and Access Management.

Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.

Package inspector provides the client and types for making API requests to Amazon Inspector.

Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.

Package iot provides the client and types for making API requests to AWS IoT.

Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.

Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.

Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.

Package kinesis provides the client and types for making API requests to Amazon Kinesis.

Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.

Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics.

Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.

Package kms provides the client and types for making API requests to AWS Key Management Service.

Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.

Package lambda provides the client and types for making API requests to AWS Lambda.

Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.

Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.

Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.

Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.

Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.

Package lightsail provides the client and types for making API requests to Amazon Lightsail.

Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.

Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.

Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.

Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.

Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.

Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.

Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.

Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.

Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.

Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.

Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.

Package mturk provides the client and types for making API requests to Amazon Mechanical Turk.

Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.

Package opsworks provides the client and types for making API requests to AWS OpsWorks.

Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.

Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate.

Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code.

Package organizations provides the client and types for making API requests to AWS Organizations.

Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.

Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.

Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.

Package polly provides the client and types for making API requests to Amazon Polly.

Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.

Package rds provides the client and types for making API requests to Amazon Relational Database Service.

Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.

Package redshift provides the client and types for making API requests to Amazon Redshift.

Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.

Package rekognition provides the client and types for making API requests to Amazon Rekognition.

Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.

Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.

Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.

Package route53 provides the client and types for making API requests to Amazon Route 53.

Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.

Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.

Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.

Package s3 provides the client and types for making API requests to Amazon Simple Storage Service.

Package s3crypto provides encryption to S3 using KMS and AES GCM.

Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.

Package s3manager provides utilities to upload and download objects from S3 concurrently.

Package s3manageriface provides an interface for the s3manager package

Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.

Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.

Package ses provides the client and types for making API requests to Amazon Simple Email Service.

Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.

Package sfn provides the client and types for making API requests to AWS Step Functions.

Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.

Package shield provides the client and types for making API requests to AWS Shield.

Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.

Package simpledb provides the client and types for making API requests to Amazon SimpleDB.

Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.

Package sms provides the client and types for making API requests to AWS Server Migration Service.

Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.

Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball.

Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.

Package sns provides the client and types for making API requests to Amazon Simple Notification Service.

Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.

Package sqs provides the client and types for making API requests to Amazon Simple Queue Service.

Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.

Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM).

Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.

Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.

Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.

Package sts provides the client and types for making API requests to AWS Security Token Service.

Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.

Package support provides the client and types for making API requests to AWS Support.

Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.

Package swf provides the client and types for making API requests to Amazon Simple Workflow Service.

Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.

Package waf provides the client and types for making API requests to AWS WAF.

Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.

Package wafregional provides the client and types for making API requests to AWS WAF Regional.

Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.

Package workdocs provides the client and types for making API requests to Amazon WorkDocs.

Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.

Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.

Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.

Package xray provides the client and types for making API requests to AWS X-Ray.

Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.

Package spew implements a deep pretty printer for Go data structures to aid in debugging.

Package chi is a small, idiomatic and composable router for building HTTP services.

Limits ====== This example demonstrates the use of Timeout, CloseNotify, and Throttle middlewares.

Custom Structured Logger ======================== This example demonstrates how to use middleware.RequestLogger, middleware.LogFormatter and middleware.LogEntry to build a structured logger using the amazing sirupsen/logrus package as the logging backend.

REST ==== This example demonstrates a HTTP REST web service with some fixture data.

Todos Resource ============== This example demonstrates a project structure that defines a subrouter and its handlers on a struct, and mounting them as subrouters to a parent router.

Versions ======== This example demonstrates the use of the render subpackage, with a quick concept for how to support multiple api versions.

Package ini provides INI file read and write functionality in Go.

Basic command line interface for debug and testing purposes.

Package envconfig implements decoding of environment variables based on a user defined specification.

Package starwars provides a example schema and resolver based on Star Wars characters.

Package errors provides simple error handling primitives.

Package difflib is a partial port of Python difflib module.

Package logrus is a structured logger for Go, completely API compatible with the standard library logger.

The Test package is used for testing logrus.

objx - Go package for dealing with maps, slices, JSON and other data.

Package testify is a set of packages that provide many tools for testifying that your code will behave as you intend.

Package assert provides a set of comprehensive testing tools for use with the normal Go testing system.

Package http DEPRECATED USE net/http/httptest

Package mock provides a system by which it is possible to mock your objects and verify calls are happening as expected.

Package require implements the same assertions as the `assert` package but stops test execution when a test fails.

Package suite contains logic for creating testing suite structs and running the methods on those structs as tests.

Package bpf implements marshaling and unmarshaling of programs for the Berkeley Packet Filter virtual machine, and provides a Go implementation of the virtual machine.

Package context defines the Context type, which carries deadlines, cancelation signals, and other request-scoped values across API boundaries and between processes.

Package ctxhttp provides helper functions for performing context-aware HTTP requests.

Package dict implements the Dictionary Server Protocol as defined in RFC 2229.

Package dnsmessage provides a mostly RFC 1035 compliant implementation of DNS message packing and unpacking.

Package html implements an HTML5-compliant tokenizer and parser.

Package atom provides integer codes (also known as atoms) for a fixed set of frequently occurring HTML strings: tag names and attribute keys such as "p" and "id".

Package charset provides common text encodings for HTML documents.

Package http2 implements the HTTP/2 protocol.

The h2i command is an interactive HTTP/2 console.

Package hpack implements HPACK, a compression format for efficiently representing HTTP header fields in the context of HTTP/2.

Package icmp provides basic functions for the manipulation of messages used in the Internet Control Message Protocols, ICMPv4 and ICMPv6.

Package idna implements IDNA2008 using the compatibility processing defined by UTS (Unicode Technical Standard) #46, which defines a standard to deal with the transition from IDNA2003.

Package ipv4 implements IP-level socket options for the Internet Protocol version 4.

Package ipv6 implements IP-level socket options for the Internet Protocol version 6.

Package httplex contains rules around lexical matters of various HTTP-related specifications.

Package nettest provides utilities for network testing.

Package netutil provides network utility functions, complementing the more common ones in the net package.

Package proxy provides support for a variety of protocols to proxy network data.

Package publicsuffix provides a public suffix list based on data from http://publicsuffix.org/.

Package route provides basic functions for the manipulation of packet routing facilities on BSD variants.

Package trace implements tracing of requests and long-lived objects.

Package webdav provides a WebDAV server implementation.

Package websocket implements a client and server for the WebSocket protocol as specified in RFC 6455.

Package xsrftoken provides methods for generating and validating secure XSRF tokens.

Package unix contains an interface to the low-level operating system primitives.

Package svc provides everything required to build Windows service.

Package debug provides facilities to execute svc.Handler on console.

Package eventlog implements access to Windows event log.

Example service program that beeps.

Package mgr can be used to manage Windows service programs.