Directories
¶
Path | Synopsis |
---|---|
Package accessanalyzer provides the client and types for making API requests to Access Analyzer.
|
Package accessanalyzer provides the client and types for making API requests to Access Analyzer. |
accessanalyzeriface
Package accessanalyzeriface provides an interface to enable mocking the Access Analyzer service client for testing your code.
|
Package accessanalyzeriface provides an interface to enable mocking the Access Analyzer service client for testing your code. |
Package account provides the client and types for making API requests to AWS Account.
|
Package account provides the client and types for making API requests to AWS Account. |
accountiface
Package accountiface provides an interface to enable mocking the AWS Account service client for testing your code.
|
Package accountiface provides an interface to enable mocking the AWS Account service client for testing your code. |
Package acm provides the client and types for making API requests to AWS Certificate Manager.
|
Package acm provides the client and types for making API requests to AWS Certificate Manager. |
acmiface
Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
|
Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code. |
Package acmpca provides the client and types for making API requests to AWS Certificate Manager Private Certificate Authority.
|
Package acmpca provides the client and types for making API requests to AWS Certificate Manager Private Certificate Authority. |
acmpcaiface
Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code.
|
Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code. |
Package alexaforbusiness provides the client and types for making API requests to Alexa For Business.
|
Package alexaforbusiness provides the client and types for making API requests to Alexa For Business. |
alexaforbusinessiface
Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code.
|
Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code. |
Package amplify provides the client and types for making API requests to AWS Amplify.
|
Package amplify provides the client and types for making API requests to AWS Amplify. |
amplifyiface
Package amplifyiface provides an interface to enable mocking the AWS Amplify service client for testing your code.
|
Package amplifyiface provides an interface to enable mocking the AWS Amplify service client for testing your code. |
Package amplifybackend provides the client and types for making API requests to AmplifyBackend.
|
Package amplifybackend provides the client and types for making API requests to AmplifyBackend. |
amplifybackendiface
Package amplifybackendiface provides an interface to enable mocking the AmplifyBackend service client for testing your code.
|
Package amplifybackendiface provides an interface to enable mocking the AmplifyBackend service client for testing your code. |
Package amplifyuibuilder provides the client and types for making API requests to AWS Amplify UI Builder.
|
Package amplifyuibuilder provides the client and types for making API requests to AWS Amplify UI Builder. |
amplifyuibuilderiface
Package amplifyuibuilderiface provides an interface to enable mocking the AWS Amplify UI Builder service client for testing your code.
|
Package amplifyuibuilderiface provides an interface to enable mocking the AWS Amplify UI Builder service client for testing your code. |
Package apigateway provides the client and types for making API requests to Amazon API Gateway.
|
Package apigateway provides the client and types for making API requests to Amazon API Gateway. |
apigatewayiface
Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
|
Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code. |
Package apigatewaymanagementapi provides the client and types for making API requests to AmazonApiGatewayManagementApi.
|
Package apigatewaymanagementapi provides the client and types for making API requests to AmazonApiGatewayManagementApi. |
apigatewaymanagementapiiface
Package apigatewaymanagementapiiface provides an interface to enable mocking the AmazonApiGatewayManagementApi service client for testing your code.
|
Package apigatewaymanagementapiiface provides an interface to enable mocking the AmazonApiGatewayManagementApi service client for testing your code. |
Package apigatewayv2 provides the client and types for making API requests to AmazonApiGatewayV2.
|
Package apigatewayv2 provides the client and types for making API requests to AmazonApiGatewayV2. |
apigatewayv2iface
Package apigatewayv2iface provides an interface to enable mocking the AmazonApiGatewayV2 service client for testing your code.
|
Package apigatewayv2iface provides an interface to enable mocking the AmazonApiGatewayV2 service client for testing your code. |
Package appconfig provides the client and types for making API requests to Amazon AppConfig.
|
Package appconfig provides the client and types for making API requests to Amazon AppConfig. |
appconfigiface
Package appconfigiface provides an interface to enable mocking the Amazon AppConfig service client for testing your code.
|
Package appconfigiface provides an interface to enable mocking the Amazon AppConfig service client for testing your code. |
Package appconfigdata provides the client and types for making API requests to AWS AppConfig Data.
|
Package appconfigdata provides the client and types for making API requests to AWS AppConfig Data. |
appconfigdataiface
Package appconfigdataiface provides an interface to enable mocking the AWS AppConfig Data service client for testing your code.
|
Package appconfigdataiface provides an interface to enable mocking the AWS AppConfig Data service client for testing your code. |
Package appflow provides the client and types for making API requests to Amazon Appflow.
|
Package appflow provides the client and types for making API requests to Amazon Appflow. |
appflowiface
Package appflowiface provides an interface to enable mocking the Amazon Appflow service client for testing your code.
|
Package appflowiface provides an interface to enable mocking the Amazon Appflow service client for testing your code. |
Package appintegrationsservice provides the client and types for making API requests to Amazon AppIntegrations Service.
|
Package appintegrationsservice provides the client and types for making API requests to Amazon AppIntegrations Service. |
appintegrationsserviceiface
Package appintegrationsserviceiface provides an interface to enable mocking the Amazon AppIntegrations Service service client for testing your code.
|
Package appintegrationsserviceiface provides an interface to enable mocking the Amazon AppIntegrations Service service client for testing your code. |
Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
|
Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling. |
applicationautoscalingiface
Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
|
Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code. |
Package applicationcostprofiler provides the client and types for making API requests to AWS Application Cost Profiler.
|
Package applicationcostprofiler provides the client and types for making API requests to AWS Application Cost Profiler. |
applicationcostprofileriface
Package applicationcostprofileriface provides an interface to enable mocking the AWS Application Cost Profiler service client for testing your code.
|
Package applicationcostprofileriface provides an interface to enable mocking the AWS Application Cost Profiler service client for testing your code. |
Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
|
Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service. |
applicationdiscoveryserviceiface
Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
|
Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code. |
Package applicationinsights provides the client and types for making API requests to Amazon CloudWatch Application Insights.
|
Package applicationinsights provides the client and types for making API requests to Amazon CloudWatch Application Insights. |
applicationinsightsiface
Package applicationinsightsiface provides an interface to enable mocking the Amazon CloudWatch Application Insights service client for testing your code.
|
Package applicationinsightsiface provides an interface to enable mocking the Amazon CloudWatch Application Insights service client for testing your code. |
Package appmesh provides the client and types for making API requests to AWS App Mesh.
|
Package appmesh provides the client and types for making API requests to AWS App Mesh. |
appmeshiface
Package appmeshiface provides an interface to enable mocking the AWS App Mesh service client for testing your code.
|
Package appmeshiface provides an interface to enable mocking the AWS App Mesh service client for testing your code. |
Package appregistry provides the client and types for making API requests to AWS Service Catalog App Registry.
|
Package appregistry provides the client and types for making API requests to AWS Service Catalog App Registry. |
appregistryiface
Package appregistryiface provides an interface to enable mocking the AWS Service Catalog App Registry service client for testing your code.
|
Package appregistryiface provides an interface to enable mocking the AWS Service Catalog App Registry service client for testing your code. |
Package apprunner provides the client and types for making API requests to AWS App Runner.
|
Package apprunner provides the client and types for making API requests to AWS App Runner. |
apprunneriface
Package apprunneriface provides an interface to enable mocking the AWS App Runner service client for testing your code.
|
Package apprunneriface provides an interface to enable mocking the AWS App Runner service client for testing your code. |
Package appstream provides the client and types for making API requests to Amazon AppStream.
|
Package appstream provides the client and types for making API requests to Amazon AppStream. |
appstreamiface
Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
|
Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code. |
Package appsync provides the client and types for making API requests to AWS AppSync.
|
Package appsync provides the client and types for making API requests to AWS AppSync. |
appsynciface
Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code.
|
Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code. |
Package athena provides the client and types for making API requests to Amazon Athena.
|
Package athena provides the client and types for making API requests to Amazon Athena. |
athenaiface
Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
|
Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code. |
Package auditmanager provides the client and types for making API requests to AWS Audit Manager.
|
Package auditmanager provides the client and types for making API requests to AWS Audit Manager. |
auditmanageriface
Package auditmanageriface provides an interface to enable mocking the AWS Audit Manager service client for testing your code.
|
Package auditmanageriface provides an interface to enable mocking the AWS Audit Manager service client for testing your code. |
Package augmentedairuntime provides the client and types for making API requests to Amazon Augmented AI Runtime.
|
Package augmentedairuntime provides the client and types for making API requests to Amazon Augmented AI Runtime. |
augmentedairuntimeiface
Package augmentedairuntimeiface provides an interface to enable mocking the Amazon Augmented AI Runtime service client for testing your code.
|
Package augmentedairuntimeiface provides an interface to enable mocking the Amazon Augmented AI Runtime service client for testing your code. |
Package autoscaling provides the client and types for making API requests to Auto Scaling.
|
Package autoscaling provides the client and types for making API requests to Auto Scaling. |
autoscalingiface
Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
|
Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code. |
Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans.
|
Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans. |
autoscalingplansiface
Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code.
|
Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code. |
Package backup provides the client and types for making API requests to AWS Backup.
|
Package backup provides the client and types for making API requests to AWS Backup. |
backupiface
Package backupiface provides an interface to enable mocking the AWS Backup service client for testing your code.
|
Package backupiface provides an interface to enable mocking the AWS Backup service client for testing your code. |
Package backupgateway provides the client and types for making API requests to AWS Backup Gateway.
|
Package backupgateway provides the client and types for making API requests to AWS Backup Gateway. |
backupgatewayiface
Package backupgatewayiface provides an interface to enable mocking the AWS Backup Gateway service client for testing your code.
|
Package backupgatewayiface provides an interface to enable mocking the AWS Backup Gateway service client for testing your code. |
Package batch provides the client and types for making API requests to AWS Batch.
|
Package batch provides the client and types for making API requests to AWS Batch. |
batchiface
Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
|
Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code. |
Package billingconductor provides the client and types for making API requests to AWSBillingConductor.
|
Package billingconductor provides the client and types for making API requests to AWSBillingConductor. |
billingconductoriface
Package billingconductoriface provides an interface to enable mocking the AWSBillingConductor service client for testing your code.
|
Package billingconductoriface provides an interface to enable mocking the AWSBillingConductor service client for testing your code. |
Package braket provides the client and types for making API requests to Braket.
|
Package braket provides the client and types for making API requests to Braket. |
braketiface
Package braketiface provides an interface to enable mocking the Braket service client for testing your code.
|
Package braketiface provides an interface to enable mocking the Braket service client for testing your code. |
Package budgets provides the client and types for making API requests to AWS Budgets.
|
Package budgets provides the client and types for making API requests to AWS Budgets. |
budgetsiface
Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
|
Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code. |
Package chime provides the client and types for making API requests to Amazon Chime.
|
Package chime provides the client and types for making API requests to Amazon Chime. |
chimeiface
Package chimeiface provides an interface to enable mocking the Amazon Chime service client for testing your code.
|
Package chimeiface provides an interface to enable mocking the Amazon Chime service client for testing your code. |
Package chimesdkidentity provides the client and types for making API requests to Amazon Chime SDK Identity.
|
Package chimesdkidentity provides the client and types for making API requests to Amazon Chime SDK Identity. |
chimesdkidentityiface
Package chimesdkidentityiface provides an interface to enable mocking the Amazon Chime SDK Identity service client for testing your code.
|
Package chimesdkidentityiface provides an interface to enable mocking the Amazon Chime SDK Identity service client for testing your code. |
Package chimesdkmediapipelines provides the client and types for making API requests to Amazon Chime SDK Media Pipelines.
|
Package chimesdkmediapipelines provides the client and types for making API requests to Amazon Chime SDK Media Pipelines. |
chimesdkmediapipelinesiface
Package chimesdkmediapipelinesiface provides an interface to enable mocking the Amazon Chime SDK Media Pipelines service client for testing your code.
|
Package chimesdkmediapipelinesiface provides an interface to enable mocking the Amazon Chime SDK Media Pipelines service client for testing your code. |
Package chimesdkmeetings provides the client and types for making API requests to Amazon Chime SDK Meetings.
|
Package chimesdkmeetings provides the client and types for making API requests to Amazon Chime SDK Meetings. |
chimesdkmeetingsiface
Package chimesdkmeetingsiface provides an interface to enable mocking the Amazon Chime SDK Meetings service client for testing your code.
|
Package chimesdkmeetingsiface provides an interface to enable mocking the Amazon Chime SDK Meetings service client for testing your code. |
Package chimesdkmessaging provides the client and types for making API requests to Amazon Chime SDK Messaging.
|
Package chimesdkmessaging provides the client and types for making API requests to Amazon Chime SDK Messaging. |
chimesdkmessagingiface
Package chimesdkmessagingiface provides an interface to enable mocking the Amazon Chime SDK Messaging service client for testing your code.
|
Package chimesdkmessagingiface provides an interface to enable mocking the Amazon Chime SDK Messaging service client for testing your code. |
Package cloud9 provides the client and types for making API requests to AWS Cloud9.
|
Package cloud9 provides the client and types for making API requests to AWS Cloud9. |
cloud9iface
Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code.
|
Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code. |
Package cloudcontrolapi provides the client and types for making API requests to AWS Cloud Control API.
|
Package cloudcontrolapi provides the client and types for making API requests to AWS Cloud Control API. |
cloudcontrolapiiface
Package cloudcontrolapiiface provides an interface to enable mocking the AWS Cloud Control API service client for testing your code.
|
Package cloudcontrolapiiface provides an interface to enable mocking the AWS Cloud Control API service client for testing your code. |
Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
|
Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory. |
clouddirectoryiface
Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
|
Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code. |
Package cloudformation provides the client and types for making API requests to AWS CloudFormation.
|
Package cloudformation provides the client and types for making API requests to AWS CloudFormation. |
cloudformationiface
Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
|
Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code. |
Package cloudfront provides the client and types for making API requests to Amazon CloudFront.
|
Package cloudfront provides the client and types for making API requests to Amazon CloudFront. |
cloudfrontiface
Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
|
Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code. |
sign
Package sign provides utilities to generate signed URLs for Amazon CloudFront.
|
Package sign provides utilities to generate signed URLs for Amazon CloudFront. |
Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM.
|
Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM. |
cloudhsmiface
Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
|
Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code. |
Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2.
|
Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2. |
cloudhsmv2iface
Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code.
|
Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code. |
Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
|
Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch. |
cloudsearchiface
Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
|
Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code. |
Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
|
Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain. |
cloudsearchdomainiface
Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
|
Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code. |
Package cloudtrail provides the client and types for making API requests to AWS CloudTrail.
|
Package cloudtrail provides the client and types for making API requests to AWS CloudTrail. |
cloudtrailiface
Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
|
Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code. |
Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch.
|
Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch. |
cloudwatchiface
Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
|
Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code. |
Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
|
Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events. |
cloudwatcheventsiface
Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
|
Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code. |
Package cloudwatchevidently provides the client and types for making API requests to Amazon CloudWatch Evidently.
|
Package cloudwatchevidently provides the client and types for making API requests to Amazon CloudWatch Evidently. |
cloudwatchevidentlyiface
Package cloudwatchevidentlyiface provides an interface to enable mocking the Amazon CloudWatch Evidently service client for testing your code.
|
Package cloudwatchevidentlyiface provides an interface to enable mocking the Amazon CloudWatch Evidently service client for testing your code. |
Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
|
Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs. |
cloudwatchlogsiface
Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
|
Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code. |
Package cloudwatchrum provides the client and types for making API requests to CloudWatch RUM.
|
Package cloudwatchrum provides the client and types for making API requests to CloudWatch RUM. |
cloudwatchrumiface
Package cloudwatchrumiface provides an interface to enable mocking the CloudWatch RUM service client for testing your code.
|
Package cloudwatchrumiface provides an interface to enable mocking the CloudWatch RUM service client for testing your code. |
Package codeartifact provides the client and types for making API requests to CodeArtifact.
|
Package codeartifact provides the client and types for making API requests to CodeArtifact. |
codeartifactiface
Package codeartifactiface provides an interface to enable mocking the CodeArtifact service client for testing your code.
|
Package codeartifactiface provides an interface to enable mocking the CodeArtifact service client for testing your code. |
Package codebuild provides the client and types for making API requests to AWS CodeBuild.
|
Package codebuild provides the client and types for making API requests to AWS CodeBuild. |
codebuildiface
Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
|
Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code. |
Package codecommit provides the client and types for making API requests to AWS CodeCommit.
|
Package codecommit provides the client and types for making API requests to AWS CodeCommit. |
codecommitiface
Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
|
Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code. |
Package codedeploy provides the client and types for making API requests to AWS CodeDeploy.
|
Package codedeploy provides the client and types for making API requests to AWS CodeDeploy. |
codedeployiface
Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
|
Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code. |
Package codeguruprofiler provides the client and types for making API requests to Amazon CodeGuru Profiler.
|
Package codeguruprofiler provides the client and types for making API requests to Amazon CodeGuru Profiler. |
codeguruprofileriface
Package codeguruprofileriface provides an interface to enable mocking the Amazon CodeGuru Profiler service client for testing your code.
|
Package codeguruprofileriface provides an interface to enable mocking the Amazon CodeGuru Profiler service client for testing your code. |
Package codegurureviewer provides the client and types for making API requests to Amazon CodeGuru Reviewer.
|
Package codegurureviewer provides the client and types for making API requests to Amazon CodeGuru Reviewer. |
codegururevieweriface
Package codegururevieweriface provides an interface to enable mocking the Amazon CodeGuru Reviewer service client for testing your code.
|
Package codegururevieweriface provides an interface to enable mocking the Amazon CodeGuru Reviewer service client for testing your code. |
Package codepipeline provides the client and types for making API requests to AWS CodePipeline.
|
Package codepipeline provides the client and types for making API requests to AWS CodePipeline. |
codepipelineiface
Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
|
Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code. |
Package codestar provides the client and types for making API requests to AWS CodeStar.
|
Package codestar provides the client and types for making API requests to AWS CodeStar. |
codestariface
Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
|
Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code. |
Package codestarconnections provides the client and types for making API requests to AWS CodeStar connections.
|
Package codestarconnections provides the client and types for making API requests to AWS CodeStar connections. |
codestarconnectionsiface
Package codestarconnectionsiface provides an interface to enable mocking the AWS CodeStar connections service client for testing your code.
|
Package codestarconnectionsiface provides an interface to enable mocking the AWS CodeStar connections service client for testing your code. |
Package codestarnotifications provides the client and types for making API requests to AWS CodeStar Notifications.
|
Package codestarnotifications provides the client and types for making API requests to AWS CodeStar Notifications. |
codestarnotificationsiface
Package codestarnotificationsiface provides an interface to enable mocking the AWS CodeStar Notifications service client for testing your code.
|
Package codestarnotificationsiface provides an interface to enable mocking the AWS CodeStar Notifications service client for testing your code. |
Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
|
Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity. |
cognitoidentityiface
Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
|
Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code. |
Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
|
Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider. |
cognitoidentityprovideriface
Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
|
Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code. |
Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
|
Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync. |
cognitosynciface
Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
|
Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code. |
Package comprehend provides the client and types for making API requests to Amazon Comprehend.
|
Package comprehend provides the client and types for making API requests to Amazon Comprehend. |
comprehendiface
Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code.
|
Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code. |
Package comprehendmedical provides the client and types for making API requests to AWS Comprehend Medical.
|
Package comprehendmedical provides the client and types for making API requests to AWS Comprehend Medical. |
comprehendmedicaliface
Package comprehendmedicaliface provides an interface to enable mocking the AWS Comprehend Medical service client for testing your code.
|
Package comprehendmedicaliface provides an interface to enable mocking the AWS Comprehend Medical service client for testing your code. |
Package computeoptimizer provides the client and types for making API requests to AWS Compute Optimizer.
|
Package computeoptimizer provides the client and types for making API requests to AWS Compute Optimizer. |
computeoptimizeriface
Package computeoptimizeriface provides an interface to enable mocking the AWS Compute Optimizer service client for testing your code.
|
Package computeoptimizeriface provides an interface to enable mocking the AWS Compute Optimizer service client for testing your code. |
Package configservice provides the client and types for making API requests to AWS Config.
|
Package configservice provides the client and types for making API requests to AWS Config. |
configserviceiface
Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
|
Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code. |
Package connect provides the client and types for making API requests to Amazon Connect Service.
|
Package connect provides the client and types for making API requests to Amazon Connect Service. |
connectiface
Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code.
|
Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code. |
Package connectcampaigns provides the client and types for making API requests to AmazonConnectCampaignService.
|
Package connectcampaigns provides the client and types for making API requests to AmazonConnectCampaignService. |
connectcampaignsiface
Package connectcampaignsiface provides an interface to enable mocking the AmazonConnectCampaignService service client for testing your code.
|
Package connectcampaignsiface provides an interface to enable mocking the AmazonConnectCampaignService service client for testing your code. |
Package connectcontactlens provides the client and types for making API requests to Amazon Connect Contact Lens.
|
Package connectcontactlens provides the client and types for making API requests to Amazon Connect Contact Lens. |
connectcontactlensiface
Package connectcontactlensiface provides an interface to enable mocking the Amazon Connect Contact Lens service client for testing your code.
|
Package connectcontactlensiface provides an interface to enable mocking the Amazon Connect Contact Lens service client for testing your code. |
Package connectparticipant provides the client and types for making API requests to Amazon Connect Participant Service.
|
Package connectparticipant provides the client and types for making API requests to Amazon Connect Participant Service. |
connectparticipantiface
Package connectparticipantiface provides an interface to enable mocking the Amazon Connect Participant Service service client for testing your code.
|
Package connectparticipantiface provides an interface to enable mocking the Amazon Connect Participant Service service client for testing your code. |
Package connectwisdomservice provides the client and types for making API requests to Amazon Connect Wisdom Service.
|
Package connectwisdomservice provides the client and types for making API requests to Amazon Connect Wisdom Service. |
connectwisdomserviceiface
Package connectwisdomserviceiface provides an interface to enable mocking the Amazon Connect Wisdom Service service client for testing your code.
|
Package connectwisdomserviceiface provides an interface to enable mocking the Amazon Connect Wisdom Service service client for testing your code. |
Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
|
Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service. |
costandusagereportserviceiface
Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
|
Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code. |
Package costexplorer provides the client and types for making API requests to AWS Cost Explorer Service.
|
Package costexplorer provides the client and types for making API requests to AWS Cost Explorer Service. |
costexploreriface
Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code.
|
Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code. |
Package customerprofiles provides the client and types for making API requests to Amazon Connect Customer Profiles.
|
Package customerprofiles provides the client and types for making API requests to Amazon Connect Customer Profiles. |
customerprofilesiface
Package customerprofilesiface provides an interface to enable mocking the Amazon Connect Customer Profiles service client for testing your code.
|
Package customerprofilesiface provides an interface to enable mocking the Amazon Connect Customer Profiles service client for testing your code. |
Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
|
Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service. |
databasemigrationserviceiface
Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
|
Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code. |
Package dataexchange provides the client and types for making API requests to AWS Data Exchange.
|
Package dataexchange provides the client and types for making API requests to AWS Data Exchange. |
dataexchangeiface
Package dataexchangeiface provides an interface to enable mocking the AWS Data Exchange service client for testing your code.
|
Package dataexchangeiface provides an interface to enable mocking the AWS Data Exchange service client for testing your code. |
Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.
|
Package datapipeline provides the client and types for making API requests to AWS Data Pipeline. |
datapipelineiface
Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
|
Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code. |
Package datasync provides the client and types for making API requests to AWS DataSync.
|
Package datasync provides the client and types for making API requests to AWS DataSync. |
datasynciface
Package datasynciface provides an interface to enable mocking the AWS DataSync service client for testing your code.
|
Package datasynciface provides an interface to enable mocking the AWS DataSync service client for testing your code. |
Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX).
|
Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX). |
daxiface
Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
|
Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code. |
Package detective provides the client and types for making API requests to Amazon Detective.
|
Package detective provides the client and types for making API requests to Amazon Detective. |
detectiveiface
Package detectiveiface provides an interface to enable mocking the Amazon Detective service client for testing your code.
|
Package detectiveiface provides an interface to enable mocking the Amazon Detective service client for testing your code. |
Package devicefarm provides the client and types for making API requests to AWS Device Farm.
|
Package devicefarm provides the client and types for making API requests to AWS Device Farm. |
devicefarmiface
Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
|
Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code. |
Package devopsguru provides the client and types for making API requests to Amazon DevOps Guru.
|
Package devopsguru provides the client and types for making API requests to Amazon DevOps Guru. |
devopsguruiface
Package devopsguruiface provides an interface to enable mocking the Amazon DevOps Guru service client for testing your code.
|
Package devopsguruiface provides an interface to enable mocking the Amazon DevOps Guru service client for testing your code. |
Package directconnect provides the client and types for making API requests to AWS Direct Connect.
|
Package directconnect provides the client and types for making API requests to AWS Direct Connect. |
directconnectiface
Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
|
Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code. |
Package directoryservice provides the client and types for making API requests to AWS Directory Service.
|
Package directoryservice provides the client and types for making API requests to AWS Directory Service. |
directoryserviceiface
Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
|
Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code. |
Package dlm provides the client and types for making API requests to Amazon Data Lifecycle Manager.
|
Package dlm provides the client and types for making API requests to Amazon Data Lifecycle Manager. |
dlmiface
Package dlmiface provides an interface to enable mocking the Amazon Data Lifecycle Manager service client for testing your code.
|
Package dlmiface provides an interface to enable mocking the Amazon Data Lifecycle Manager service client for testing your code. |
Package docdb provides the client and types for making API requests to Amazon DocumentDB with MongoDB compatibility.
|
Package docdb provides the client and types for making API requests to Amazon DocumentDB with MongoDB compatibility. |
docdbiface
Package docdbiface provides an interface to enable mocking the Amazon DocumentDB with MongoDB compatibility service client for testing your code.
|
Package docdbiface provides an interface to enable mocking the Amazon DocumentDB with MongoDB compatibility service client for testing your code. |
Package drs provides the client and types for making API requests to Elastic Disaster Recovery Service.
|
Package drs provides the client and types for making API requests to Elastic Disaster Recovery Service. |
drsiface
Package drsiface provides an interface to enable mocking the Elastic Disaster Recovery Service service client for testing your code.
|
Package drsiface provides an interface to enable mocking the Elastic Disaster Recovery Service service client for testing your code. |
Package dynamodb provides the client and types for making API requests to Amazon DynamoDB.
|
Package dynamodb provides the client and types for making API requests to Amazon DynamoDB. |
dynamodbattribute
Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
|
Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues. |
dynamodbiface
Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
|
Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code. |
expression
Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps.
|
Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps. |
Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
|
Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams. |
dynamodbstreamsiface
Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
|
Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code. |
Package ebs provides the client and types for making API requests to Amazon Elastic Block Store.
|
Package ebs provides the client and types for making API requests to Amazon Elastic Block Store. |
ebsiface
Package ebsiface provides an interface to enable mocking the Amazon Elastic Block Store service client for testing your code.
|
Package ebsiface provides an interface to enable mocking the Amazon Elastic Block Store service client for testing your code. |
Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud.
|
Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud. |
ec2iface
Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
|
Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code. |
Package ec2instanceconnect provides the client and types for making API requests to AWS EC2 Instance Connect.
|
Package ec2instanceconnect provides the client and types for making API requests to AWS EC2 Instance Connect. |
ec2instanceconnectiface
Package ec2instanceconnectiface provides an interface to enable mocking the AWS EC2 Instance Connect service client for testing your code.
|
Package ec2instanceconnectiface provides an interface to enable mocking the AWS EC2 Instance Connect service client for testing your code. |
Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry.
|
Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry. |
ecriface
Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
|
Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code. |
Package ecrpublic provides the client and types for making API requests to Amazon Elastic Container Registry Public.
|
Package ecrpublic provides the client and types for making API requests to Amazon Elastic Container Registry Public. |
ecrpubliciface
Package ecrpubliciface provides an interface to enable mocking the Amazon Elastic Container Registry Public service client for testing your code.
|
Package ecrpubliciface provides an interface to enable mocking the Amazon Elastic Container Registry Public service client for testing your code. |
Package ecs provides the client and types for making API requests to Amazon EC2 Container Service.
|
Package ecs provides the client and types for making API requests to Amazon EC2 Container Service. |
ecsiface
Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
|
Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code. |
Package efs provides the client and types for making API requests to Amazon Elastic File System.
|
Package efs provides the client and types for making API requests to Amazon Elastic File System. |
efsiface
Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
|
Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code. |
Package eks provides the client and types for making API requests to Amazon Elastic Kubernetes Service.
|
Package eks provides the client and types for making API requests to Amazon Elastic Kubernetes Service. |
eksiface
Package eksiface provides an interface to enable mocking the Amazon Elastic Kubernetes Service service client for testing your code.
|
Package eksiface provides an interface to enable mocking the Amazon Elastic Kubernetes Service service client for testing your code. |
Package elasticache provides the client and types for making API requests to Amazon ElastiCache.
|
Package elasticache provides the client and types for making API requests to Amazon ElastiCache. |
elasticacheiface
Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
|
Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code. |
Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk.
|
Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk. |
elasticbeanstalkiface
Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
|
Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code. |
Package elasticinference provides the client and types for making API requests to Amazon Elastic Inference.
|
Package elasticinference provides the client and types for making API requests to Amazon Elastic Inference. |
elasticinferenceiface
Package elasticinferenceiface provides an interface to enable mocking the Amazon Elastic Inference service client for testing your code.
|
Package elasticinferenceiface provides an interface to enable mocking the Amazon Elastic Inference service client for testing your code. |
Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
|
Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service. |
elasticsearchserviceiface
Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
|
Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code. |
Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
|
Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder. |
elastictranscoderiface
Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
|
Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code. |
Package elb provides the client and types for making API requests to Elastic Load Balancing.
|
Package elb provides the client and types for making API requests to Elastic Load Balancing. |
elbiface
Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
|
Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. |
Package elbv2 provides the client and types for making API requests to Elastic Load Balancing.
|
Package elbv2 provides the client and types for making API requests to Elastic Load Balancing. |
elbv2iface
Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
|
Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. |
Package emr provides the client and types for making API requests to Amazon EMR.
|
Package emr provides the client and types for making API requests to Amazon EMR. |
emriface
Package emriface provides an interface to enable mocking the Amazon EMR service client for testing your code.
|
Package emriface provides an interface to enable mocking the Amazon EMR service client for testing your code. |
Package emrcontainers provides the client and types for making API requests to Amazon EMR Containers.
|
Package emrcontainers provides the client and types for making API requests to Amazon EMR Containers. |
emrcontainersiface
Package emrcontainersiface provides an interface to enable mocking the Amazon EMR Containers service client for testing your code.
|
Package emrcontainersiface provides an interface to enable mocking the Amazon EMR Containers service client for testing your code. |
Package emrserverless provides the client and types for making API requests to EMR Serverless.
|
Package emrserverless provides the client and types for making API requests to EMR Serverless. |
emrserverlessiface
Package emrserverlessiface provides an interface to enable mocking the EMR Serverless service client for testing your code.
|
Package emrserverlessiface provides an interface to enable mocking the EMR Serverless service client for testing your code. |
Package eventbridge provides the client and types for making API requests to Amazon EventBridge.
|
Package eventbridge provides the client and types for making API requests to Amazon EventBridge. |
eventbridgeiface
Package eventbridgeiface provides an interface to enable mocking the Amazon EventBridge service client for testing your code.
|
Package eventbridgeiface provides an interface to enable mocking the Amazon EventBridge service client for testing your code. |
Package finspace provides the client and types for making API requests to FinSpace User Environment Management service.
|
Package finspace provides the client and types for making API requests to FinSpace User Environment Management service. |
finspaceiface
Package finspaceiface provides an interface to enable mocking the FinSpace User Environment Management service service client for testing your code.
|
Package finspaceiface provides an interface to enable mocking the FinSpace User Environment Management service service client for testing your code. |
Package finspacedata provides the client and types for making API requests to FinSpace Public API.
|
Package finspacedata provides the client and types for making API requests to FinSpace Public API. |
finspacedataiface
Package finspacedataiface provides an interface to enable mocking the FinSpace Public API service client for testing your code.
|
Package finspacedataiface provides an interface to enable mocking the FinSpace Public API service client for testing your code. |
Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose.
|
Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose. |
firehoseiface
Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
|
Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code. |
Package fis provides the client and types for making API requests to AWS Fault Injection Simulator.
|
Package fis provides the client and types for making API requests to AWS Fault Injection Simulator. |
fisiface
Package fisiface provides an interface to enable mocking the AWS Fault Injection Simulator service client for testing your code.
|
Package fisiface provides an interface to enable mocking the AWS Fault Injection Simulator service client for testing your code. |
Package fms provides the client and types for making API requests to Firewall Management Service.
|
Package fms provides the client and types for making API requests to Firewall Management Service. |
fmsiface
Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code.
|
Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code. |
Package forecastqueryservice provides the client and types for making API requests to Amazon Forecast Query Service.
|
Package forecastqueryservice provides the client and types for making API requests to Amazon Forecast Query Service. |
forecastqueryserviceiface
Package forecastqueryserviceiface provides an interface to enable mocking the Amazon Forecast Query Service service client for testing your code.
|
Package forecastqueryserviceiface provides an interface to enable mocking the Amazon Forecast Query Service service client for testing your code. |
Package forecastservice provides the client and types for making API requests to Amazon Forecast Service.
|
Package forecastservice provides the client and types for making API requests to Amazon Forecast Service. |
forecastserviceiface
Package forecastserviceiface provides an interface to enable mocking the Amazon Forecast Service service client for testing your code.
|
Package forecastserviceiface provides an interface to enable mocking the Amazon Forecast Service service client for testing your code. |
Package frauddetector provides the client and types for making API requests to Amazon Fraud Detector.
|
Package frauddetector provides the client and types for making API requests to Amazon Fraud Detector. |
frauddetectoriface
Package frauddetectoriface provides an interface to enable mocking the Amazon Fraud Detector service client for testing your code.
|
Package frauddetectoriface provides an interface to enable mocking the Amazon Fraud Detector service client for testing your code. |
Package fsx provides the client and types for making API requests to Amazon FSx.
|
Package fsx provides the client and types for making API requests to Amazon FSx. |
fsxiface
Package fsxiface provides an interface to enable mocking the Amazon FSx service client for testing your code.
|
Package fsxiface provides an interface to enable mocking the Amazon FSx service client for testing your code. |
Package gamelift provides the client and types for making API requests to Amazon GameLift.
|
Package gamelift provides the client and types for making API requests to Amazon GameLift. |
gameliftiface
Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
|
Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code. |
Package gamesparks provides the client and types for making API requests to GameSparks.
|
Package gamesparks provides the client and types for making API requests to GameSparks. |
gamesparksiface
Package gamesparksiface provides an interface to enable mocking the GameSparks service client for testing your code.
|
Package gamesparksiface provides an interface to enable mocking the GameSparks service client for testing your code. |
Package glacier provides the client and types for making API requests to Amazon Glacier.
|
Package glacier provides the client and types for making API requests to Amazon Glacier. |
glacieriface
Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
|
Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code. |
Package globalaccelerator provides the client and types for making API requests to AWS Global Accelerator.
|
Package globalaccelerator provides the client and types for making API requests to AWS Global Accelerator. |
globalacceleratoriface
Package globalacceleratoriface provides an interface to enable mocking the AWS Global Accelerator service client for testing your code.
|
Package globalacceleratoriface provides an interface to enable mocking the AWS Global Accelerator service client for testing your code. |
Package glue provides the client and types for making API requests to AWS Glue.
|
Package glue provides the client and types for making API requests to AWS Glue. |
glueiface
Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code.
|
Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code. |
Package gluedatabrew provides the client and types for making API requests to AWS Glue DataBrew.
|
Package gluedatabrew provides the client and types for making API requests to AWS Glue DataBrew. |
gluedatabrewiface
Package gluedatabrewiface provides an interface to enable mocking the AWS Glue DataBrew service client for testing your code.
|
Package gluedatabrewiface provides an interface to enable mocking the AWS Glue DataBrew service client for testing your code. |
Package greengrass provides the client and types for making API requests to AWS Greengrass.
|
Package greengrass provides the client and types for making API requests to AWS Greengrass. |
greengrassiface
Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
|
Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code. |
Package greengrassv2 provides the client and types for making API requests to AWS IoT Greengrass V2.
|
Package greengrassv2 provides the client and types for making API requests to AWS IoT Greengrass V2. |
greengrassv2iface
Package greengrassv2iface provides an interface to enable mocking the AWS IoT Greengrass V2 service client for testing your code.
|
Package greengrassv2iface provides an interface to enable mocking the AWS IoT Greengrass V2 service client for testing your code. |
Package groundstation provides the client and types for making API requests to AWS Ground Station.
|
Package groundstation provides the client and types for making API requests to AWS Ground Station. |
groundstationiface
Package groundstationiface provides an interface to enable mocking the AWS Ground Station service client for testing your code.
|
Package groundstationiface provides an interface to enable mocking the AWS Ground Station service client for testing your code. |
Package guardduty provides the client and types for making API requests to Amazon GuardDuty.
|
Package guardduty provides the client and types for making API requests to Amazon GuardDuty. |
guarddutyiface
Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code.
|
Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code. |
Package health provides the client and types for making API requests to AWS Health APIs and Notifications.
|
Package health provides the client and types for making API requests to AWS Health APIs and Notifications. |
healthiface
Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
|
Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code. |
Package healthlake provides the client and types for making API requests to Amazon HealthLake.
|
Package healthlake provides the client and types for making API requests to Amazon HealthLake. |
healthlakeiface
Package healthlakeiface provides an interface to enable mocking the Amazon HealthLake service client for testing your code.
|
Package healthlakeiface provides an interface to enable mocking the Amazon HealthLake service client for testing your code. |
Package honeycode provides the client and types for making API requests to Amazon Honeycode.
|
Package honeycode provides the client and types for making API requests to Amazon Honeycode. |
honeycodeiface
Package honeycodeiface provides an interface to enable mocking the Amazon Honeycode service client for testing your code.
|
Package honeycodeiface provides an interface to enable mocking the Amazon Honeycode service client for testing your code. |
Package iam provides the client and types for making API requests to AWS Identity and Access Management.
|
Package iam provides the client and types for making API requests to AWS Identity and Access Management. |
iamiface
Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
|
Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code. |
Package identitystore provides the client and types for making API requests to AWS SSO Identity Store.
|
Package identitystore provides the client and types for making API requests to AWS SSO Identity Store. |
identitystoreiface
Package identitystoreiface provides an interface to enable mocking the AWS SSO Identity Store service client for testing your code.
|
Package identitystoreiface provides an interface to enable mocking the AWS SSO Identity Store service client for testing your code. |
Package imagebuilder provides the client and types for making API requests to EC2 Image Builder.
|
Package imagebuilder provides the client and types for making API requests to EC2 Image Builder. |
imagebuilderiface
Package imagebuilderiface provides an interface to enable mocking the EC2 Image Builder service client for testing your code.
|
Package imagebuilderiface provides an interface to enable mocking the EC2 Image Builder service client for testing your code. |
Package inspector provides the client and types for making API requests to Amazon Inspector.
|
Package inspector provides the client and types for making API requests to Amazon Inspector. |
inspectoriface
Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
|
Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code. |
Package inspector2 provides the client and types for making API requests to Inspector2.
|
Package inspector2 provides the client and types for making API requests to Inspector2. |
inspector2iface
Package inspector2iface provides an interface to enable mocking the Inspector2 service client for testing your code.
|
Package inspector2iface provides an interface to enable mocking the Inspector2 service client for testing your code. |
Package iot provides the client and types for making API requests to AWS IoT. IoT provides secure, bi-directional communication between Internet-connected devices (such as sensors, actuators, embedded devices, or smart appliances) and the Amazon Web Services cloud.
|
Package iot provides the client and types for making API requests to AWS IoT. IoT provides secure, bi-directional communication between Internet-connected devices (such as sensors, actuators, embedded devices, or smart appliances) and the Amazon Web Services cloud. |
iotiface
Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
|
Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code. |
Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service.
|
Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service. |
iot1clickdevicesserviceiface
Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code.
|
Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code. |
Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects Service.
|
Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects Service. |
iot1clickprojectsiface
Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code.
|
Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code. |
Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics.
|
Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics. |
iotanalyticsiface
Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code.
|
Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code. |
Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
|
Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane. |
iotdataplaneiface
Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
|
Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code. |
Package iotdeviceadvisor provides the client and types for making API requests to AWS IoT Core Device Advisor.
|
Package iotdeviceadvisor provides the client and types for making API requests to AWS IoT Core Device Advisor. |
iotdeviceadvisoriface
Package iotdeviceadvisoriface provides an interface to enable mocking the AWS IoT Core Device Advisor service client for testing your code.
|
Package iotdeviceadvisoriface provides an interface to enable mocking the AWS IoT Core Device Advisor service client for testing your code. |
Package iotevents provides the client and types for making API requests to AWS IoT Events.
|
Package iotevents provides the client and types for making API requests to AWS IoT Events. |
ioteventsiface
Package ioteventsiface provides an interface to enable mocking the AWS IoT Events service client for testing your code.
|
Package ioteventsiface provides an interface to enable mocking the AWS IoT Events service client for testing your code. |
Package ioteventsdata provides the client and types for making API requests to AWS IoT Events Data.
|
Package ioteventsdata provides the client and types for making API requests to AWS IoT Events Data. |
ioteventsdataiface
Package ioteventsdataiface provides an interface to enable mocking the AWS IoT Events Data service client for testing your code.
|
Package ioteventsdataiface provides an interface to enable mocking the AWS IoT Events Data service client for testing your code. |
Package iotfleethub provides the client and types for making API requests to AWS IoT Fleet Hub.
|
Package iotfleethub provides the client and types for making API requests to AWS IoT Fleet Hub. |
iotfleethubiface
Package iotfleethubiface provides an interface to enable mocking the AWS IoT Fleet Hub service client for testing your code.
|
Package iotfleethubiface provides an interface to enable mocking the AWS IoT Fleet Hub service client for testing your code. |
Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane.
|
Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane. |
iotjobsdataplaneiface
Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code.
|
Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code. |
Package iotsecuretunneling provides the client and types for making API requests to AWS IoT Secure Tunneling.
|
Package iotsecuretunneling provides the client and types for making API requests to AWS IoT Secure Tunneling. |
iotsecuretunnelingiface
Package iotsecuretunnelingiface provides an interface to enable mocking the AWS IoT Secure Tunneling service client for testing your code.
|
Package iotsecuretunnelingiface provides an interface to enable mocking the AWS IoT Secure Tunneling service client for testing your code. |
Package iotsitewise provides the client and types for making API requests to AWS IoT SiteWise.
|
Package iotsitewise provides the client and types for making API requests to AWS IoT SiteWise. |
iotsitewiseiface
Package iotsitewiseiface provides an interface to enable mocking the AWS IoT SiteWise service client for testing your code.
|
Package iotsitewiseiface provides an interface to enable mocking the AWS IoT SiteWise service client for testing your code. |
Package iotthingsgraph provides the client and types for making API requests to AWS IoT Things Graph.
|
Package iotthingsgraph provides the client and types for making API requests to AWS IoT Things Graph. |
iotthingsgraphiface
Package iotthingsgraphiface provides an interface to enable mocking the AWS IoT Things Graph service client for testing your code.
|
Package iotthingsgraphiface provides an interface to enable mocking the AWS IoT Things Graph service client for testing your code. |
Package iottwinmaker provides the client and types for making API requests to AWS IoT TwinMaker.
|
Package iottwinmaker provides the client and types for making API requests to AWS IoT TwinMaker. |
iottwinmakeriface
Package iottwinmakeriface provides an interface to enable mocking the AWS IoT TwinMaker service client for testing your code.
|
Package iottwinmakeriface provides an interface to enable mocking the AWS IoT TwinMaker service client for testing your code. |
Package iotwireless provides the client and types for making API requests to AWS IoT Wireless.
|
Package iotwireless provides the client and types for making API requests to AWS IoT Wireless. |
iotwirelessiface
Package iotwirelessiface provides an interface to enable mocking the AWS IoT Wireless service client for testing your code.
|
Package iotwirelessiface provides an interface to enable mocking the AWS IoT Wireless service client for testing your code. |
Package ivs provides the client and types for making API requests to Amazon Interactive Video Service.
|
Package ivs provides the client and types for making API requests to Amazon Interactive Video Service. |
ivsiface
Package ivsiface provides an interface to enable mocking the Amazon Interactive Video Service service client for testing your code.
|
Package ivsiface provides an interface to enable mocking the Amazon Interactive Video Service service client for testing your code. |
Package ivschat provides the client and types for making API requests to Amazon Interactive Video Service Chat.
|
Package ivschat provides the client and types for making API requests to Amazon Interactive Video Service Chat. |
ivschatiface
Package ivschatiface provides an interface to enable mocking the Amazon Interactive Video Service Chat service client for testing your code.
|
Package ivschatiface provides an interface to enable mocking the Amazon Interactive Video Service Chat service client for testing your code. |
Package kafka provides the client and types for making API requests to Managed Streaming for Kafka.
|
Package kafka provides the client and types for making API requests to Managed Streaming for Kafka. |
kafkaiface
Package kafkaiface provides an interface to enable mocking the Managed Streaming for Kafka service client for testing your code.
|
Package kafkaiface provides an interface to enable mocking the Managed Streaming for Kafka service client for testing your code. |
Package kafkaconnect provides the client and types for making API requests to Managed Streaming for Kafka Connect.
|
Package kafkaconnect provides the client and types for making API requests to Managed Streaming for Kafka Connect. |
kafkaconnectiface
Package kafkaconnectiface provides an interface to enable mocking the Managed Streaming for Kafka Connect service client for testing your code.
|
Package kafkaconnectiface provides an interface to enable mocking the Managed Streaming for Kafka Connect service client for testing your code. |
Package kendra provides the client and types for making API requests to AWSKendraFrontendService.
|
Package kendra provides the client and types for making API requests to AWSKendraFrontendService. |
kendraiface
Package kendraiface provides an interface to enable mocking the AWSKendraFrontendService service client for testing your code.
|
Package kendraiface provides an interface to enable mocking the AWSKendraFrontendService service client for testing your code. |
Package keyspaces provides the client and types for making API requests to Amazon Keyspaces.
|
Package keyspaces provides the client and types for making API requests to Amazon Keyspaces. |
keyspacesiface
Package keyspacesiface provides an interface to enable mocking the Amazon Keyspaces service client for testing your code.
|
Package keyspacesiface provides an interface to enable mocking the Amazon Keyspaces service client for testing your code. |
Package kinesis provides the client and types for making API requests to Amazon Kinesis.
|
Package kinesis provides the client and types for making API requests to Amazon Kinesis. |
kinesisiface
Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
|
Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code. |
Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics.
|
Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics. |
kinesisanalyticsiface
Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
|
Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code. |
Package kinesisanalyticsv2 provides the client and types for making API requests to Amazon Kinesis Analytics.
|
Package kinesisanalyticsv2 provides the client and types for making API requests to Amazon Kinesis Analytics. |
kinesisanalyticsv2iface
Package kinesisanalyticsv2iface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
|
Package kinesisanalyticsv2iface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code. |
Package kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams.
|
Package kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams. |
kinesisvideoiface
Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code.
|
Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code. |
Package kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media.
|
Package kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media. |
kinesisvideoarchivedmediaiface
Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code.
|
Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code. |
Package kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media.
|
Package kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media. |
kinesisvideomediaiface
Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code.
|
Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code. |
Package kinesisvideosignalingchannels provides the client and types for making API requests to Amazon Kinesis Video Signaling Channels.
|
Package kinesisvideosignalingchannels provides the client and types for making API requests to Amazon Kinesis Video Signaling Channels. |
kinesisvideosignalingchannelsiface
Package kinesisvideosignalingchannelsiface provides an interface to enable mocking the Amazon Kinesis Video Signaling Channels service client for testing your code.
|
Package kinesisvideosignalingchannelsiface provides an interface to enable mocking the Amazon Kinesis Video Signaling Channels service client for testing your code. |
Package kms provides the client and types for making API requests to AWS Key Management Service.
|
Package kms provides the client and types for making API requests to AWS Key Management Service. |
kmsiface
Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
|
Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code. |
Package lakeformation provides the client and types for making API requests to AWS Lake Formation.
|
Package lakeformation provides the client and types for making API requests to AWS Lake Formation. |
lakeformationiface
Package lakeformationiface provides an interface to enable mocking the AWS Lake Formation service client for testing your code.
|
Package lakeformationiface provides an interface to enable mocking the AWS Lake Formation service client for testing your code. |
Package lambda provides the client and types for making API requests to AWS Lambda.
|
Package lambda provides the client and types for making API requests to AWS Lambda. |
lambdaiface
Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
|
Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code. |
Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
|
Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service. |
lexmodelbuildingserviceiface
Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
|
Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code. |
Package lexmodelsv2 provides the client and types for making API requests to Amazon Lex Model Building V2.
|
Package lexmodelsv2 provides the client and types for making API requests to Amazon Lex Model Building V2. |
lexmodelsv2iface
Package lexmodelsv2iface provides an interface to enable mocking the Amazon Lex Model Building V2 service client for testing your code.
|
Package lexmodelsv2iface provides an interface to enable mocking the Amazon Lex Model Building V2 service client for testing your code. |
Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
|
Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service. |
lexruntimeserviceiface
Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
|
Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code. |
Package lexruntimev2 provides the client and types for making API requests to Amazon Lex Runtime V2.
|
Package lexruntimev2 provides the client and types for making API requests to Amazon Lex Runtime V2. |
lexruntimev2iface
Package lexruntimev2iface provides an interface to enable mocking the Amazon Lex Runtime V2 service client for testing your code.
|
Package lexruntimev2iface provides an interface to enable mocking the Amazon Lex Runtime V2 service client for testing your code. |
Package licensemanager provides the client and types for making API requests to AWS License Manager.
|
Package licensemanager provides the client and types for making API requests to AWS License Manager. |
licensemanageriface
Package licensemanageriface provides an interface to enable mocking the AWS License Manager service client for testing your code.
|
Package licensemanageriface provides an interface to enable mocking the AWS License Manager service client for testing your code. |
Package lightsail provides the client and types for making API requests to Amazon Lightsail.
|
Package lightsail provides the client and types for making API requests to Amazon Lightsail. |
lightsailiface
Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
|
Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code. |
Package locationservice provides the client and types for making API requests to Amazon Location Service.
|
Package locationservice provides the client and types for making API requests to Amazon Location Service. |
locationserviceiface
Package locationserviceiface provides an interface to enable mocking the Amazon Location Service service client for testing your code.
|
Package locationserviceiface provides an interface to enable mocking the Amazon Location Service service client for testing your code. |
Package lookoutequipment provides the client and types for making API requests to Amazon Lookout for Equipment.
|
Package lookoutequipment provides the client and types for making API requests to Amazon Lookout for Equipment. |
lookoutequipmentiface
Package lookoutequipmentiface provides an interface to enable mocking the Amazon Lookout for Equipment service client for testing your code.
|
Package lookoutequipmentiface provides an interface to enable mocking the Amazon Lookout for Equipment service client for testing your code. |
Package lookoutforvision provides the client and types for making API requests to Amazon Lookout for Vision.
|
Package lookoutforvision provides the client and types for making API requests to Amazon Lookout for Vision. |
lookoutforvisioniface
Package lookoutforvisioniface provides an interface to enable mocking the Amazon Lookout for Vision service client for testing your code.
|
Package lookoutforvisioniface provides an interface to enable mocking the Amazon Lookout for Vision service client for testing your code. |
Package lookoutmetrics provides the client and types for making API requests to Amazon Lookout for Metrics.
|
Package lookoutmetrics provides the client and types for making API requests to Amazon Lookout for Metrics. |
lookoutmetricsiface
Package lookoutmetricsiface provides an interface to enable mocking the Amazon Lookout for Metrics service client for testing your code.
|
Package lookoutmetricsiface provides an interface to enable mocking the Amazon Lookout for Metrics service client for testing your code. |
Package m2 provides the client and types for making API requests to AWSMainframeModernization.
|
Package m2 provides the client and types for making API requests to AWSMainframeModernization. |
m2iface
Package m2iface provides an interface to enable mocking the AWSMainframeModernization service client for testing your code.
|
Package m2iface provides an interface to enable mocking the AWSMainframeModernization service client for testing your code. |
Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.
|
Package machinelearning provides the client and types for making API requests to Amazon Machine Learning. |
machinelearningiface
Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
|
Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code. |
Package macie provides the client and types for making API requests to Amazon Macie.
|
Package macie provides the client and types for making API requests to Amazon Macie. |
macieiface
Package macieiface provides an interface to enable mocking the Amazon Macie service client for testing your code.
|
Package macieiface provides an interface to enable mocking the Amazon Macie service client for testing your code. |
Package macie2 provides the client and types for making API requests to Amazon Macie 2.
|
Package macie2 provides the client and types for making API requests to Amazon Macie 2. |
macie2iface
Package macie2iface provides an interface to enable mocking the Amazon Macie 2 service client for testing your code.
|
Package macie2iface provides an interface to enable mocking the Amazon Macie 2 service client for testing your code. |
Package managedblockchain provides the client and types for making API requests to Amazon Managed Blockchain.
|
Package managedblockchain provides the client and types for making API requests to Amazon Managed Blockchain. |
managedblockchainiface
Package managedblockchainiface provides an interface to enable mocking the Amazon Managed Blockchain service client for testing your code.
|
Package managedblockchainiface provides an interface to enable mocking the Amazon Managed Blockchain service client for testing your code. |
Package managedgrafana provides the client and types for making API requests to Amazon Managed Grafana.
|
Package managedgrafana provides the client and types for making API requests to Amazon Managed Grafana. |
managedgrafanaiface
Package managedgrafanaiface provides an interface to enable mocking the Amazon Managed Grafana service client for testing your code.
|
Package managedgrafanaiface provides an interface to enable mocking the Amazon Managed Grafana service client for testing your code. |
Package marketplacecatalog provides the client and types for making API requests to AWS Marketplace Catalog Service.
|
Package marketplacecatalog provides the client and types for making API requests to AWS Marketplace Catalog Service. |
marketplacecatalogiface
Package marketplacecatalogiface provides an interface to enable mocking the AWS Marketplace Catalog Service service client for testing your code.
|
Package marketplacecatalogiface provides an interface to enable mocking the AWS Marketplace Catalog Service service client for testing your code. |
Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
|
Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics. |
marketplacecommerceanalyticsiface
Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
|
Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code. |
Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
|
Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service. |
marketplaceentitlementserviceiface
Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
|
Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code. |
Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
|
Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering. |
marketplacemeteringiface
Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
|
Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code. |
Package mediaconnect provides the client and types for making API requests to AWS MediaConnect.
|
Package mediaconnect provides the client and types for making API requests to AWS MediaConnect. |
mediaconnectiface
Package mediaconnectiface provides an interface to enable mocking the AWS MediaConnect service client for testing your code.
|
Package mediaconnectiface provides an interface to enable mocking the AWS MediaConnect service client for testing your code. |
Package mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert.
|
Package mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert. |
mediaconvertiface
Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code.
|
Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code. |
Package medialive provides the client and types for making API requests to AWS Elemental MediaLive.
|
Package medialive provides the client and types for making API requests to AWS Elemental MediaLive. |
medialiveiface
Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code.
|
Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code. |
Package mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage.
|
Package mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage. |
mediapackageiface
Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code.
|
Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code. |
Package mediapackagevod provides the client and types for making API requests to AWS Elemental MediaPackage VOD.
|
Package mediapackagevod provides the client and types for making API requests to AWS Elemental MediaPackage VOD. |
mediapackagevodiface
Package mediapackagevodiface provides an interface to enable mocking the AWS Elemental MediaPackage VOD service client for testing your code.
|
Package mediapackagevodiface provides an interface to enable mocking the AWS Elemental MediaPackage VOD service client for testing your code. |
Package mediastore provides the client and types for making API requests to AWS Elemental MediaStore.
|
Package mediastore provides the client and types for making API requests to AWS Elemental MediaStore. |
mediastoreiface
Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code.
|
Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code. |
Package mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane.
|
Package mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane. |
mediastoredataiface
Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code.
|
Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code. |
Package mediatailor provides the client and types for making API requests to AWS MediaTailor.
|
Package mediatailor provides the client and types for making API requests to AWS MediaTailor. |
mediatailoriface
Package mediatailoriface provides an interface to enable mocking the AWS MediaTailor service client for testing your code.
|
Package mediatailoriface provides an interface to enable mocking the AWS MediaTailor service client for testing your code. |
Package memorydb provides the client and types for making API requests to Amazon MemoryDB.
|
Package memorydb provides the client and types for making API requests to Amazon MemoryDB. |
memorydbiface
Package memorydbiface provides an interface to enable mocking the Amazon MemoryDB service client for testing your code.
|
Package memorydbiface provides an interface to enable mocking the Amazon MemoryDB service client for testing your code. |
Package mgn provides the client and types for making API requests to Application Migration Service.
|
Package mgn provides the client and types for making API requests to Application Migration Service. |
mgniface
Package mgniface provides an interface to enable mocking the Application Migration Service service client for testing your code.
|
Package mgniface provides an interface to enable mocking the Application Migration Service service client for testing your code. |
Package migrationhub provides the client and types for making API requests to AWS Migration Hub.
|
Package migrationhub provides the client and types for making API requests to AWS Migration Hub. |
migrationhubiface
Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code.
|
Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code. |
Package migrationhubconfig provides the client and types for making API requests to AWS Migration Hub Config.
|
Package migrationhubconfig provides the client and types for making API requests to AWS Migration Hub Config. |
migrationhubconfigiface
Package migrationhubconfigiface provides an interface to enable mocking the AWS Migration Hub Config service client for testing your code.
|
Package migrationhubconfigiface provides an interface to enable mocking the AWS Migration Hub Config service client for testing your code. |
Package migrationhubrefactorspaces provides the client and types for making API requests to AWS Migration Hub Refactor Spaces.
|
Package migrationhubrefactorspaces provides the client and types for making API requests to AWS Migration Hub Refactor Spaces. |
migrationhubrefactorspacesiface
Package migrationhubrefactorspacesiface provides an interface to enable mocking the AWS Migration Hub Refactor Spaces service client for testing your code.
|
Package migrationhubrefactorspacesiface provides an interface to enable mocking the AWS Migration Hub Refactor Spaces service client for testing your code. |
Package migrationhubstrategyrecommendations provides the client and types for making API requests to Migration Hub Strategy Recommendations.
|
Package migrationhubstrategyrecommendations provides the client and types for making API requests to Migration Hub Strategy Recommendations. |
migrationhubstrategyrecommendationsiface
Package migrationhubstrategyrecommendationsiface provides an interface to enable mocking the Migration Hub Strategy Recommendations service client for testing your code.
|
Package migrationhubstrategyrecommendationsiface provides an interface to enable mocking the Migration Hub Strategy Recommendations service client for testing your code. |
Package mobile provides the client and types for making API requests to AWS Mobile.
|
Package mobile provides the client and types for making API requests to AWS Mobile. |
mobileiface
Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code.
|
Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code. |
Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
|
Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics. |
mobileanalyticsiface
Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
|
Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code. |
Package mq provides the client and types for making API requests to AmazonMQ.
|
Package mq provides the client and types for making API requests to AmazonMQ. |
mqiface
Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code.
|
Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code. |
Package mturk provides the client and types for making API requests to Amazon Mechanical Turk.
|
Package mturk provides the client and types for making API requests to Amazon Mechanical Turk. |
mturkiface
Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
|
Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code. |
Package mwaa provides the client and types for making API requests to AmazonMWAA.
|
Package mwaa provides the client and types for making API requests to AmazonMWAA. |
mwaaiface
Package mwaaiface provides an interface to enable mocking the AmazonMWAA service client for testing your code.
|
Package mwaaiface provides an interface to enable mocking the AmazonMWAA service client for testing your code. |
Package neptune provides the client and types for making API requests to Amazon Neptune.
|
Package neptune provides the client and types for making API requests to Amazon Neptune. |
neptuneiface
Package neptuneiface provides an interface to enable mocking the Amazon Neptune service client for testing your code.
|
Package neptuneiface provides an interface to enable mocking the Amazon Neptune service client for testing your code. |
Package networkfirewall provides the client and types for making API requests to AWS Network Firewall.
|
Package networkfirewall provides the client and types for making API requests to AWS Network Firewall. |
networkfirewalliface
Package networkfirewalliface provides an interface to enable mocking the AWS Network Firewall service client for testing your code.
|
Package networkfirewalliface provides an interface to enable mocking the AWS Network Firewall service client for testing your code. |
Package networkmanager provides the client and types for making API requests to AWS Network Manager.
|
Package networkmanager provides the client and types for making API requests to AWS Network Manager. |
networkmanageriface
Package networkmanageriface provides an interface to enable mocking the AWS Network Manager service client for testing your code.
|
Package networkmanageriface provides an interface to enable mocking the AWS Network Manager service client for testing your code. |
Package nimblestudio provides the client and types for making API requests to AmazonNimbleStudio.
|
Package nimblestudio provides the client and types for making API requests to AmazonNimbleStudio. |
nimblestudioiface
Package nimblestudioiface provides an interface to enable mocking the AmazonNimbleStudio service client for testing your code.
|
Package nimblestudioiface provides an interface to enable mocking the AmazonNimbleStudio service client for testing your code. |
Package opensearchservice provides the client and types for making API requests to Amazon OpenSearch Service.
|
Package opensearchservice provides the client and types for making API requests to Amazon OpenSearch Service. |
opensearchserviceiface
Package opensearchserviceiface provides an interface to enable mocking the Amazon OpenSearch Service service client for testing your code.
|
Package opensearchserviceiface provides an interface to enable mocking the Amazon OpenSearch Service service client for testing your code. |
Package opsworks provides the client and types for making API requests to AWS OpsWorks.
|
Package opsworks provides the client and types for making API requests to AWS OpsWorks. |
opsworksiface
Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
|
Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code. |
Package opsworkscm provides the client and types for making API requests to AWS OpsWorks CM.
|
Package opsworkscm provides the client and types for making API requests to AWS OpsWorks CM. |
opsworkscmiface
Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks CM service client for testing your code.
|
Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks CM service client for testing your code. |
Package organizations provides the client and types for making API requests to AWS Organizations.
|
Package organizations provides the client and types for making API requests to AWS Organizations. |
organizationsiface
Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
|
Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code. |
Package outposts provides the client and types for making API requests to AWS Outposts.
|
Package outposts provides the client and types for making API requests to AWS Outposts. |
outpostsiface
Package outpostsiface provides an interface to enable mocking the AWS Outposts service client for testing your code.
|
Package outpostsiface provides an interface to enable mocking the AWS Outposts service client for testing your code. |
Package panorama provides the client and types for making API requests to AWS Panorama.
|
Package panorama provides the client and types for making API requests to AWS Panorama. |
panoramaiface
Package panoramaiface provides an interface to enable mocking the AWS Panorama service client for testing your code.
|
Package panoramaiface provides an interface to enable mocking the AWS Panorama service client for testing your code. |
Package personalize provides the client and types for making API requests to Amazon Personalize.
|
Package personalize provides the client and types for making API requests to Amazon Personalize. |
personalizeiface
Package personalizeiface provides an interface to enable mocking the Amazon Personalize service client for testing your code.
|
Package personalizeiface provides an interface to enable mocking the Amazon Personalize service client for testing your code. |
Package personalizeevents provides the client and types for making API requests to Amazon Personalize Events.
|
Package personalizeevents provides the client and types for making API requests to Amazon Personalize Events. |
personalizeeventsiface
Package personalizeeventsiface provides an interface to enable mocking the Amazon Personalize Events service client for testing your code.
|
Package personalizeeventsiface provides an interface to enable mocking the Amazon Personalize Events service client for testing your code. |
Package personalizeruntime provides the client and types for making API requests to Amazon Personalize Runtime.
|
Package personalizeruntime provides the client and types for making API requests to Amazon Personalize Runtime. |
personalizeruntimeiface
Package personalizeruntimeiface provides an interface to enable mocking the Amazon Personalize Runtime service client for testing your code.
|
Package personalizeruntimeiface provides an interface to enable mocking the Amazon Personalize Runtime service client for testing your code. |
Package pi provides the client and types for making API requests to AWS Performance Insights.
|
Package pi provides the client and types for making API requests to AWS Performance Insights. |
piiface
Package piiface provides an interface to enable mocking the AWS Performance Insights service client for testing your code.
|
Package piiface provides an interface to enable mocking the AWS Performance Insights service client for testing your code. |
Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.
|
Package pinpoint provides the client and types for making API requests to Amazon Pinpoint. |
pinpointiface
Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
|
Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code. |
Package pinpointemail provides the client and types for making API requests to Amazon Pinpoint Email Service.
|
Package pinpointemail provides the client and types for making API requests to Amazon Pinpoint Email Service. |
pinpointemailiface
Package pinpointemailiface provides an interface to enable mocking the Amazon Pinpoint Email Service service client for testing your code.
|
Package pinpointemailiface provides an interface to enable mocking the Amazon Pinpoint Email Service service client for testing your code. |
Package pinpointsmsvoice provides the client and types for making API requests to Amazon Pinpoint SMS and Voice Service.
|
Package pinpointsmsvoice provides the client and types for making API requests to Amazon Pinpoint SMS and Voice Service. |
pinpointsmsvoiceiface
Package pinpointsmsvoiceiface provides an interface to enable mocking the Amazon Pinpoint SMS and Voice Service service client for testing your code.
|
Package pinpointsmsvoiceiface provides an interface to enable mocking the Amazon Pinpoint SMS and Voice Service service client for testing your code. |
Package pinpointsmsvoicev2 provides the client and types for making API requests to Amazon Pinpoint SMS Voice V2.
|
Package pinpointsmsvoicev2 provides the client and types for making API requests to Amazon Pinpoint SMS Voice V2. |
pinpointsmsvoicev2iface
Package pinpointsmsvoicev2iface provides an interface to enable mocking the Amazon Pinpoint SMS Voice V2 service client for testing your code.
|
Package pinpointsmsvoicev2iface provides an interface to enable mocking the Amazon Pinpoint SMS Voice V2 service client for testing your code. |
Package polly provides the client and types for making API requests to Amazon Polly.
|
Package polly provides the client and types for making API requests to Amazon Polly. |
pollyiface
Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
|
Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code. |
Package pricing provides the client and types for making API requests to AWS Price List Service.
|
Package pricing provides the client and types for making API requests to AWS Price List Service. |
pricingiface
Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code.
|
Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code. |
Package prometheusservice provides the client and types for making API requests to Amazon Prometheus Service.
|
Package prometheusservice provides the client and types for making API requests to Amazon Prometheus Service. |
prometheusserviceiface
Package prometheusserviceiface provides an interface to enable mocking the Amazon Prometheus Service service client for testing your code.
|
Package prometheusserviceiface provides an interface to enable mocking the Amazon Prometheus Service service client for testing your code. |
Package proton provides the client and types for making API requests to AWS Proton.
|
Package proton provides the client and types for making API requests to AWS Proton. |
protoniface
Package protoniface provides an interface to enable mocking the AWS Proton service client for testing your code.
|
Package protoniface provides an interface to enable mocking the AWS Proton service client for testing your code. |
Package qldb provides the client and types for making API requests to Amazon QLDB.
|
Package qldb provides the client and types for making API requests to Amazon QLDB. |
qldbiface
Package qldbiface provides an interface to enable mocking the Amazon QLDB service client for testing your code.
|
Package qldbiface provides an interface to enable mocking the Amazon QLDB service client for testing your code. |
Package qldbsession provides the client and types for making API requests to Amazon QLDB Session.
|
Package qldbsession provides the client and types for making API requests to Amazon QLDB Session. |
qldbsessioniface
Package qldbsessioniface provides an interface to enable mocking the Amazon QLDB Session service client for testing your code.
|
Package qldbsessioniface provides an interface to enable mocking the Amazon QLDB Session service client for testing your code. |
Package quicksight provides the client and types for making API requests to Amazon QuickSight.
|
Package quicksight provides the client and types for making API requests to Amazon QuickSight. |
quicksightiface
Package quicksightiface provides an interface to enable mocking the Amazon QuickSight service client for testing your code.
|
Package quicksightiface provides an interface to enable mocking the Amazon QuickSight service client for testing your code. |
Package ram provides the client and types for making API requests to AWS Resource Access Manager.
|
Package ram provides the client and types for making API requests to AWS Resource Access Manager. |
ramiface
Package ramiface provides an interface to enable mocking the AWS Resource Access Manager service client for testing your code.
|
Package ramiface provides an interface to enable mocking the AWS Resource Access Manager service client for testing your code. |
Package rds provides the client and types for making API requests to Amazon Relational Database Service.
|
Package rds provides the client and types for making API requests to Amazon Relational Database Service. |
rdsiface
Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
|
Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code. |
rdsutils
Package rdsutils is used to generate authentication tokens used to connect to a givent Amazon Relational Database Service (RDS) database.
|
Package rdsutils is used to generate authentication tokens used to connect to a givent Amazon Relational Database Service (RDS) database. |
Package rdsdataservice provides the client and types for making API requests to AWS RDS DataService.
|
Package rdsdataservice provides the client and types for making API requests to AWS RDS DataService. |
rdsdataserviceiface
Package rdsdataserviceiface provides an interface to enable mocking the AWS RDS DataService service client for testing your code.
|
Package rdsdataserviceiface provides an interface to enable mocking the AWS RDS DataService service client for testing your code. |
Package recyclebin provides the client and types for making API requests to Amazon Recycle Bin.
|
Package recyclebin provides the client and types for making API requests to Amazon Recycle Bin. |
recyclebiniface
Package recyclebiniface provides an interface to enable mocking the Amazon Recycle Bin service client for testing your code.
|
Package recyclebiniface provides an interface to enable mocking the Amazon Recycle Bin service client for testing your code. |
Package redshift provides the client and types for making API requests to Amazon Redshift.
|
Package redshift provides the client and types for making API requests to Amazon Redshift. |
redshiftiface
Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
|
Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code. |
Package redshiftdataapiservice provides the client and types for making API requests to Redshift Data API Service.
|
Package redshiftdataapiservice provides the client and types for making API requests to Redshift Data API Service. |
redshiftdataapiserviceiface
Package redshiftdataapiserviceiface provides an interface to enable mocking the Redshift Data API Service service client for testing your code.
|
Package redshiftdataapiserviceiface provides an interface to enable mocking the Redshift Data API Service service client for testing your code. |
Package rekognition provides the client and types for making API requests to Amazon Rekognition.
|
Package rekognition provides the client and types for making API requests to Amazon Rekognition. |
rekognitioniface
Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
|
Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code. |
Package resiliencehub provides the client and types for making API requests to AWS Resilience Hub.
|
Package resiliencehub provides the client and types for making API requests to AWS Resilience Hub. |
resiliencehubiface
Package resiliencehubiface provides an interface to enable mocking the AWS Resilience Hub service client for testing your code.
|
Package resiliencehubiface provides an interface to enable mocking the AWS Resilience Hub service client for testing your code. |
Package resourcegroups provides the client and types for making API requests to AWS Resource Groups.
|
Package resourcegroups provides the client and types for making API requests to AWS Resource Groups. |
resourcegroupsiface
Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code.
|
Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code. |
Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
|
Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API. |
resourcegroupstaggingapiiface
Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
|
Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code. |
Package robomaker provides the client and types for making API requests to AWS RoboMaker.
|
Package robomaker provides the client and types for making API requests to AWS RoboMaker. |
robomakeriface
Package robomakeriface provides an interface to enable mocking the AWS RoboMaker service client for testing your code.
|
Package robomakeriface provides an interface to enable mocking the AWS RoboMaker service client for testing your code. |
Package route53 provides the client and types for making API requests to Amazon Route 53.
|
Package route53 provides the client and types for making API requests to Amazon Route 53. |
route53iface
Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
|
Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code. |
Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
|
Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains. |
route53domainsiface
Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
|
Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code. |
Package route53recoverycluster provides the client and types for making API requests to Route53 Recovery Cluster.
|
Package route53recoverycluster provides the client and types for making API requests to Route53 Recovery Cluster. |
route53recoveryclusteriface
Package route53recoveryclusteriface provides an interface to enable mocking the Route53 Recovery Cluster service client for testing your code.
|
Package route53recoveryclusteriface provides an interface to enable mocking the Route53 Recovery Cluster service client for testing your code. |
Package route53recoverycontrolconfig provides the client and types for making API requests to AWS Route53 Recovery Control Config.
|
Package route53recoverycontrolconfig provides the client and types for making API requests to AWS Route53 Recovery Control Config. |
route53recoverycontrolconfigiface
Package route53recoverycontrolconfigiface provides an interface to enable mocking the AWS Route53 Recovery Control Config service client for testing your code.
|
Package route53recoverycontrolconfigiface provides an interface to enable mocking the AWS Route53 Recovery Control Config service client for testing your code. |
Package route53recoveryreadiness provides the client and types for making API requests to AWS Route53 Recovery Readiness.
|
Package route53recoveryreadiness provides the client and types for making API requests to AWS Route53 Recovery Readiness. |
route53recoveryreadinessiface
Package route53recoveryreadinessiface provides an interface to enable mocking the AWS Route53 Recovery Readiness service client for testing your code.
|
Package route53recoveryreadinessiface provides an interface to enable mocking the AWS Route53 Recovery Readiness service client for testing your code. |
Package route53resolver provides the client and types for making API requests to Amazon Route 53 Resolver.
|
Package route53resolver provides the client and types for making API requests to Amazon Route 53 Resolver. |
route53resolveriface
Package route53resolveriface provides an interface to enable mocking the Amazon Route 53 Resolver service client for testing your code.
|
Package route53resolveriface provides an interface to enable mocking the Amazon Route 53 Resolver service client for testing your code. |
Package s3 provides the client and types for making API requests to Amazon Simple Storage Service.
|
Package s3 provides the client and types for making API requests to Amazon Simple Storage Service. |
s3crypto
Package s3crypto provides encryption to S3 using KMS and AES GCM.
|
Package s3crypto provides encryption to S3 using KMS and AES GCM. |
s3iface
Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
|
Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code. |
s3manager
Package s3manager provides utilities to upload and download objects from S3 concurrently.
|
Package s3manager provides utilities to upload and download objects from S3 concurrently. |
s3manager/s3manageriface
Package s3manageriface provides an interface for the s3manager package
|
Package s3manageriface provides an interface for the s3manager package |
Package s3control provides the client and types for making API requests to AWS S3 Control.
|
Package s3control provides the client and types for making API requests to AWS S3 Control. |
s3controliface
Package s3controliface provides an interface to enable mocking the AWS S3 Control service client for testing your code.
|
Package s3controliface provides an interface to enable mocking the AWS S3 Control service client for testing your code. |
Package s3outposts provides the client and types for making API requests to Amazon S3 on Outposts.
|
Package s3outposts provides the client and types for making API requests to Amazon S3 on Outposts. |
s3outpostsiface
Package s3outpostsiface provides an interface to enable mocking the Amazon S3 on Outposts service client for testing your code.
|
Package s3outpostsiface provides an interface to enable mocking the Amazon S3 on Outposts service client for testing your code. |
Package sagemaker provides the client and types for making API requests to Amazon SageMaker Service.
|
Package sagemaker provides the client and types for making API requests to Amazon SageMaker Service. |
sagemakeriface
Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code.
|
Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code. |
Package sagemakeredgemanager provides the client and types for making API requests to Amazon Sagemaker Edge Manager.
|
Package sagemakeredgemanager provides the client and types for making API requests to Amazon Sagemaker Edge Manager. |
sagemakeredgemanageriface
Package sagemakeredgemanageriface provides an interface to enable mocking the Amazon Sagemaker Edge Manager service client for testing your code.
|
Package sagemakeredgemanageriface provides an interface to enable mocking the Amazon Sagemaker Edge Manager service client for testing your code. |
Package sagemakerfeaturestoreruntime provides the client and types for making API requests to Amazon SageMaker Feature Store Runtime.
|
Package sagemakerfeaturestoreruntime provides the client and types for making API requests to Amazon SageMaker Feature Store Runtime. |
sagemakerfeaturestoreruntimeiface
Package sagemakerfeaturestoreruntimeiface provides an interface to enable mocking the Amazon SageMaker Feature Store Runtime service client for testing your code.
|
Package sagemakerfeaturestoreruntimeiface provides an interface to enable mocking the Amazon SageMaker Feature Store Runtime service client for testing your code. |
Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime.
|
Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime. |
sagemakerruntimeiface
Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code.
|
Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code. |
Package savingsplans provides the client and types for making API requests to AWS Savings Plans.
|
Package savingsplans provides the client and types for making API requests to AWS Savings Plans. |
savingsplansiface
Package savingsplansiface provides an interface to enable mocking the AWS Savings Plans service client for testing your code.
|
Package savingsplansiface provides an interface to enable mocking the AWS Savings Plans service client for testing your code. |
Package schemas provides the client and types for making API requests to Schemas.
|
Package schemas provides the client and types for making API requests to Schemas. |
schemasiface
Package schemasiface provides an interface to enable mocking the Schemas service client for testing your code.
|
Package schemasiface provides an interface to enable mocking the Schemas service client for testing your code. |
Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager.
|
Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager. |
secretsmanageriface
Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code.
|
Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code. |
Package securityhub provides the client and types for making API requests to AWS SecurityHub.
|
Package securityhub provides the client and types for making API requests to AWS SecurityHub. |
securityhubiface
Package securityhubiface provides an interface to enable mocking the AWS SecurityHub service client for testing your code.
|
Package securityhubiface provides an interface to enable mocking the AWS SecurityHub service client for testing your code. |
Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository.
|
Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository. |
serverlessapplicationrepositoryiface
Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code.
|
Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code. |
Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.
|
Package servicecatalog provides the client and types for making API requests to AWS Service Catalog. |
servicecatalogiface
Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
|
Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code. |
Package servicediscovery provides the client and types for making API requests to AWS Cloud Map.
|
Package servicediscovery provides the client and types for making API requests to AWS Cloud Map. |
servicediscoveryiface
Package servicediscoveryiface provides an interface to enable mocking the AWS Cloud Map service client for testing your code.
|
Package servicediscoveryiface provides an interface to enable mocking the AWS Cloud Map service client for testing your code. |
Package servicequotas provides the client and types for making API requests to Service Quotas.
|
Package servicequotas provides the client and types for making API requests to Service Quotas. |
servicequotasiface
Package servicequotasiface provides an interface to enable mocking the Service Quotas service client for testing your code.
|
Package servicequotasiface provides an interface to enable mocking the Service Quotas service client for testing your code. |
Package ses provides the client and types for making API requests to Amazon Simple Email Service.
|
Package ses provides the client and types for making API requests to Amazon Simple Email Service. |
sesiface
Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
|
Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code. |
Package sesv2 provides the client and types for making API requests to Amazon Simple Email Service.
|
Package sesv2 provides the client and types for making API requests to Amazon Simple Email Service. |
sesv2iface
Package sesv2iface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
|
Package sesv2iface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code. |
Package sfn provides the client and types for making API requests to AWS Step Functions.
|
Package sfn provides the client and types for making API requests to AWS Step Functions. |
sfniface
Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
|
Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code. |
Package shield provides the client and types for making API requests to AWS Shield.
|
Package shield provides the client and types for making API requests to AWS Shield. |
shieldiface
Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
|
Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code. |
Package signer provides the client and types for making API requests to AWS Signer.
|
Package signer provides the client and types for making API requests to AWS Signer. |
signeriface
Package signeriface provides an interface to enable mocking the AWS Signer service client for testing your code.
|
Package signeriface provides an interface to enable mocking the AWS Signer service client for testing your code. |
Package simpledb provides the client and types for making API requests to Amazon SimpleDB.
|
Package simpledb provides the client and types for making API requests to Amazon SimpleDB. |
simpledbiface
Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
|
Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code. |
Package sms provides the client and types for making API requests to AWS Server Migration Service.
|
Package sms provides the client and types for making API requests to AWS Server Migration Service. |
smsiface
Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
|
Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code. |
Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball.
|
Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball. |
snowballiface
Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
|
Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code. |
Package snowdevicemanagement provides the client and types for making API requests to AWS Snow Device Management.
|
Package snowdevicemanagement provides the client and types for making API requests to AWS Snow Device Management. |
snowdevicemanagementiface
Package snowdevicemanagementiface provides an interface to enable mocking the AWS Snow Device Management service client for testing your code.
|
Package snowdevicemanagementiface provides an interface to enable mocking the AWS Snow Device Management service client for testing your code. |
Package sns provides the client and types for making API requests to Amazon Simple Notification Service.
|
Package sns provides the client and types for making API requests to Amazon Simple Notification Service. |
snsiface
Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
|
Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code. |
Package sqs provides the client and types for making API requests to Amazon Simple Queue Service.
|
Package sqs provides the client and types for making API requests to Amazon Simple Queue Service. |
sqsiface
Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
|
Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code. |
Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM).
|
Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM). |
ssmiface
Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
|
Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code. |
Package ssmcontacts provides the client and types for making API requests to AWS Systems Manager Incident Manager Contacts.
|
Package ssmcontacts provides the client and types for making API requests to AWS Systems Manager Incident Manager Contacts. |
ssmcontactsiface
Package ssmcontactsiface provides an interface to enable mocking the AWS Systems Manager Incident Manager Contacts service client for testing your code.
|
Package ssmcontactsiface provides an interface to enable mocking the AWS Systems Manager Incident Manager Contacts service client for testing your code. |
Package ssmincidents provides the client and types for making API requests to AWS Systems Manager Incident Manager.
|
Package ssmincidents provides the client and types for making API requests to AWS Systems Manager Incident Manager. |
ssmincidentsiface
Package ssmincidentsiface provides an interface to enable mocking the AWS Systems Manager Incident Manager service client for testing your code.
|
Package ssmincidentsiface provides an interface to enable mocking the AWS Systems Manager Incident Manager service client for testing your code. |
Package sso provides the client and types for making API requests to AWS Single Sign-On.
|
Package sso provides the client and types for making API requests to AWS Single Sign-On. |
ssoiface
Package ssoiface provides an interface to enable mocking the AWS Single Sign-On service client for testing your code.
|
Package ssoiface provides an interface to enable mocking the AWS Single Sign-On service client for testing your code. |
Package ssoadmin provides the client and types for making API requests to AWS Single Sign-On Admin.
|
Package ssoadmin provides the client and types for making API requests to AWS Single Sign-On Admin. |
ssoadminiface
Package ssoadminiface provides an interface to enable mocking the AWS Single Sign-On Admin service client for testing your code.
|
Package ssoadminiface provides an interface to enable mocking the AWS Single Sign-On Admin service client for testing your code. |
Package ssooidc provides the client and types for making API requests to AWS SSO OIDC.
|
Package ssooidc provides the client and types for making API requests to AWS SSO OIDC. |
ssooidciface
Package ssooidciface provides an interface to enable mocking the AWS SSO OIDC service client for testing your code.
|
Package ssooidciface provides an interface to enable mocking the AWS SSO OIDC service client for testing your code. |
Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.
|
Package storagegateway provides the client and types for making API requests to AWS Storage Gateway. |
storagegatewayiface
Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
|
Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code. |
Package sts provides the client and types for making API requests to AWS Security Token Service.
|
Package sts provides the client and types for making API requests to AWS Security Token Service. |
stsiface
Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
|
Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code. |
Package support provides the client and types for making API requests to AWS Support.
|
Package support provides the client and types for making API requests to AWS Support. |
supportiface
Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
|
Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code. |
Package swf provides the client and types for making API requests to Amazon Simple Workflow Service.
|
Package swf provides the client and types for making API requests to Amazon Simple Workflow Service. |
swfiface
Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
|
Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code. |
Package synthetics provides the client and types for making API requests to Synthetics.
|
Package synthetics provides the client and types for making API requests to Synthetics. |
syntheticsiface
Package syntheticsiface provides an interface to enable mocking the Synthetics service client for testing your code.
|
Package syntheticsiface provides an interface to enable mocking the Synthetics service client for testing your code. |
Package textract provides the client and types for making API requests to Amazon Textract.
|
Package textract provides the client and types for making API requests to Amazon Textract. |
textractiface
Package textractiface provides an interface to enable mocking the Amazon Textract service client for testing your code.
|
Package textractiface provides an interface to enable mocking the Amazon Textract service client for testing your code. |
Package timestreamquery provides the client and types for making API requests to Amazon Timestream Query.
|
Package timestreamquery provides the client and types for making API requests to Amazon Timestream Query. |
timestreamqueryiface
Package timestreamqueryiface provides an interface to enable mocking the Amazon Timestream Query service client for testing your code.
|
Package timestreamqueryiface provides an interface to enable mocking the Amazon Timestream Query service client for testing your code. |
Package timestreamwrite provides the client and types for making API requests to Amazon Timestream Write.
|
Package timestreamwrite provides the client and types for making API requests to Amazon Timestream Write. |
timestreamwriteiface
Package timestreamwriteiface provides an interface to enable mocking the Amazon Timestream Write service client for testing your code.
|
Package timestreamwriteiface provides an interface to enable mocking the Amazon Timestream Write service client for testing your code. |
Package transcribeservice provides the client and types for making API requests to Amazon Transcribe Service.
|
Package transcribeservice provides the client and types for making API requests to Amazon Transcribe Service. |
transcribeserviceiface
Package transcribeserviceiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code.
|
Package transcribeserviceiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code. |
Package transcribestreamingservice provides the client and types for making API requests to Amazon Transcribe Streaming Service.
|
Package transcribestreamingservice provides the client and types for making API requests to Amazon Transcribe Streaming Service. |
transcribestreamingserviceiface
Package transcribestreamingserviceiface provides an interface to enable mocking the Amazon Transcribe Streaming Service service client for testing your code.
|
Package transcribestreamingserviceiface provides an interface to enable mocking the Amazon Transcribe Streaming Service service client for testing your code. |
Package transfer provides the client and types for making API requests to AWS Transfer Family.
|
Package transfer provides the client and types for making API requests to AWS Transfer Family. |
transferiface
Package transferiface provides an interface to enable mocking the AWS Transfer Family service client for testing your code.
|
Package transferiface provides an interface to enable mocking the AWS Transfer Family service client for testing your code. |
Package translate provides the client and types for making API requests to Amazon Translate.
|
Package translate provides the client and types for making API requests to Amazon Translate. |
translateiface
Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code.
|
Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code. |
Package voiceid provides the client and types for making API requests to Amazon Voice ID.
|
Package voiceid provides the client and types for making API requests to Amazon Voice ID. |
voiceidiface
Package voiceidiface provides an interface to enable mocking the Amazon Voice ID service client for testing your code.
|
Package voiceidiface provides an interface to enable mocking the Amazon Voice ID service client for testing your code. |
Package waf provides the client and types for making API requests to AWS WAF.
|
Package waf provides the client and types for making API requests to AWS WAF. |
wafiface
Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
|
Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code. |
Package wafregional provides the client and types for making API requests to AWS WAF Regional.
|
Package wafregional provides the client and types for making API requests to AWS WAF Regional. |
wafregionaliface
Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
|
Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code. |
Package wafv2 provides the client and types for making API requests to AWS WAFV2.
|
Package wafv2 provides the client and types for making API requests to AWS WAFV2. |
wafv2iface
Package wafv2iface provides an interface to enable mocking the AWS WAFV2 service client for testing your code.
|
Package wafv2iface provides an interface to enable mocking the AWS WAFV2 service client for testing your code. |
Package wellarchitected provides the client and types for making API requests to AWS Well-Architected Tool.
|
Package wellarchitected provides the client and types for making API requests to AWS Well-Architected Tool. |
wellarchitectediface
Package wellarchitectediface provides an interface to enable mocking the AWS Well-Architected Tool service client for testing your code.
|
Package wellarchitectediface provides an interface to enable mocking the AWS Well-Architected Tool service client for testing your code. |
Package workdocs provides the client and types for making API requests to Amazon WorkDocs.
|
Package workdocs provides the client and types for making API requests to Amazon WorkDocs. |
workdocsiface
Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
|
Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code. |
Package worklink provides the client and types for making API requests to Amazon WorkLink.
|
Package worklink provides the client and types for making API requests to Amazon WorkLink. |
worklinkiface
Package worklinkiface provides an interface to enable mocking the Amazon WorkLink service client for testing your code.
|
Package worklinkiface provides an interface to enable mocking the Amazon WorkLink service client for testing your code. |
Package workmail provides the client and types for making API requests to Amazon WorkMail.
|
Package workmail provides the client and types for making API requests to Amazon WorkMail. |
workmailiface
Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code.
|
Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code. |
Package workmailmessageflow provides the client and types for making API requests to Amazon WorkMail Message Flow.
|
Package workmailmessageflow provides the client and types for making API requests to Amazon WorkMail Message Flow. |
workmailmessageflowiface
Package workmailmessageflowiface provides an interface to enable mocking the Amazon WorkMail Message Flow service client for testing your code.
|
Package workmailmessageflowiface provides an interface to enable mocking the Amazon WorkMail Message Flow service client for testing your code. |
Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.
|
Package workspaces provides the client and types for making API requests to Amazon WorkSpaces. |
workspacesiface
Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
|
Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code. |
Package workspacesweb provides the client and types for making API requests to Amazon WorkSpaces Web.
|
Package workspacesweb provides the client and types for making API requests to Amazon WorkSpaces Web. |
workspaceswebiface
Package workspaceswebiface provides an interface to enable mocking the Amazon WorkSpaces Web service client for testing your code.
|
Package workspaceswebiface provides an interface to enable mocking the Amazon WorkSpaces Web service client for testing your code. |
Package xray provides the client and types for making API requests to AWS X-Ray.
|
Package xray provides the client and types for making API requests to AWS X-Ray. |
xrayiface
Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.
|
Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code. |
Click to show internal directories.
Click to hide internal directories.