v20220901

package
v3.0.1089+incompatible Latest Latest
Warning

This package is not in the latest version of its module.

 Go to latest Published: Nov 27, 2024 License: Apache-2.0 Imports: 7 Imported by: 0

Documentation

Index

Constants

View Source 
const (

	// DryRun operation, which means the DryRun parameter is passed in yet the request will still be successful.
	DRYRUNOPERATION = "DryRunOperation"

	// Operation failed.
	FAILEDOPERATION = "FailedOperation"

	// The edge HTTPS certificate has expired. Issuing expired certificates is currently not supported.
	FAILEDOPERATION_CERTIFICATEHASEXPIRED = "FailedOperation.CertificateHasExpired"

	// The edge HTTPS certificate does not exist.
	FAILEDOPERATION_CERTIFICATENOTFOUND = "FailedOperation.CertificateNotFound"

	// Syntax error in the condition expression of the configuration file.
	FAILEDOPERATION_CONFIGCONDITIONSYNTAXERROR = "FailedOperation.ConfigConditionSyntaxError"

	// Unrecognized condition matching type.
	FAILEDOPERATION_CONFIGCONDITIONUNKNOWNTARGET = "FailedOperation.ConfigConditionUnknownTarget"

	// The value field of the condition expression cannot be empty in the configuration file.
	FAILEDOPERATION_CONFIGCONDITIONVALUEEMPTYERROR = "FailedOperation.ConfigConditionValueEmptyError"

	// The configuration file contains fields with inconsistent data types.
	FAILEDOPERATION_CONFIGFIELDTYPEERROR = "FailedOperation.ConfigFieldTypeError"

	// Syntax error in the configuration file.
	FAILEDOPERATION_CONFIGFORMATERROR = "FailedOperation.ConfigFormatError"

	// Incorrect format of the configuration file. Parsing failed.
	FAILEDOPERATION_CONFIGMALFORMEDCONTENT = "FailedOperation.ConfigMalformedContent"

	// Parameter verification error in the configuration file.
	FAILEDOPERATION_CONFIGPARAMVALIDATEERRORS = "FailedOperation.ConfigParamValidateErrors"

	// The specified field in the configuration file is not recognized, indicating a possible spelling error or incorrect placement within the file structure.
	FAILEDOPERATION_CONFIGUNKNOWNFIELD = "FailedOperation.ConfigUnknownField"

	// The current configuration file version is not supported.
	FAILEDOPERATION_CONFIGUNSUPPORTEDFORMATVERSION = "FailedOperation.ConfigUnsupportedFormatVersion"

	// Failed to create the log set. Check whether the log set name already exists.
	FAILEDOPERATION_CREATECLSLOGSETFAILED = "FailedOperation.CreateClsLogSetFailed"

	// Failed to create the log topic task. Check whether the log topic name or task name already exists.
	FAILEDOPERATION_CREATECLSLOGTOPICTASKFAILED = "FailedOperation.CreateClsLogTopicTaskFailed"

	// Authentication failed while creating a custom push task. Check whether the push address is correct.
	FAILEDOPERATION_CREATELOGTOPICTASKAUTHFAILURE = "FailedOperation.CreateLogTopicTaskAuthFailure"

	//
	FAILEDOPERATION_EDGECLIENTCERTIFICATEHASEXPIRED = "FailedOperation.EdgeClientCertificateHasExpired"

	// Another task is being deployed. Please try again later.
	FAILEDOPERATION_FUNCTIONDEPLOYING = "FailedOperation.FunctionDeploying"

	// The account balance is insufficient.
	FAILEDOPERATION_INSUFFICIENTACCOUNTBALANCE = "FailedOperation.InsufficientAccountBalance"

	// The site status is invalid.
	FAILEDOPERATION_INVALIDZONESTATUS = "FailedOperation.InvalidZoneStatus"

	// The content is missing a mandatory configuration block.
	FAILEDOPERATION_MISSINGCONFIGCHUNK = "FailedOperation.MissingConfigChunk"

	// Operation failed.
	FAILEDOPERATION_MODIFYFAILED = "FailedOperation.ModifyFailed"

	// The real-time log authentication failed.
	FAILEDOPERATION_REALTIMELOGAUTHFAILURE = "FailedOperation.RealtimeLogAuthFailure"

	// The real-time log push task does not exist.
	FAILEDOPERATION_REALTIMELOGNOTFOUND = "FailedOperation.RealtimeLogNotFound"

	// Function rule operations conflict under this site.
	FAILEDOPERATION_RULEOPERATIONCONFLICT = "FailedOperation.RuleOperationConflict"

	// Unknown configuration group type.
	FAILEDOPERATION_UNKNOWNCONFIGGROUPTYPE = "FailedOperation.UnknownConfigGroupType"

	//
	FAILEDOPERATION_UPSTREAMCLIENTCERTIFICATEHASEXPIRED = "FailedOperation.UpstreamClientCertificateHasExpired"

	// Internal error.
	INTERNALERROR = "InternalError"

	// Server error.
	INTERNALERROR_BACKENDERROR = "InternalError.BackendError"

	// The configuration is locked. Please unlock and try again.
	INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"

	// Database error.
	INTERNALERROR_DBERROR = "InternalError.DBError"

	// Failed to get configuration
	INTERNALERROR_DOMAINCONFIG = "InternalError.DomainConfig"

	// Failed to call DNSPod. Please try again later. If the issue persists, please contact the intelligent customer service or submit a ticket.
	INTERNALERROR_FAILEDTOCALLDNSPOD = "InternalError.FailedToCallDNSPod"

	// Failed to generate an upload link.
	INTERNALERROR_FAILEDTOGENERATEURL = "InternalError.FailedToGenerateUrl"

	// Failed to get the role.
	INTERNALERROR_GETROLEERROR = "InternalError.GetRoleError"

	// An unknown error occurred in the backend server.
	INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"

	// Server error.
	INTERNALERROR_QUOTASYSTEM = "InternalError.QuotaSystem"

	// The backend routing address is incorrect.
	INTERNALERROR_ROUTEERROR = "InternalError.RouteError"

	// Internal system error.
	INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"

	// Unknown error.
	INTERNALERROR_UNKNOWERROR = "InternalError.UnknowError"

	// Parameter error.
	INVALIDPARAMETER = "InvalidParameter"

	// The regex is not in the standard RE2 format.
	INVALIDPARAMETER_ACCESSREDIRECTREGEXERROR = "InvalidParameter.AccessRedirectRegexError"

	// Too many attempts. Please try again later.
	INVALIDPARAMETER_ACTIONINPROGRESS = "InvalidParameter.ActionInProgress"

	// Alias domain names do not support configuring a keyless certificate.
	INVALIDPARAMETER_ALIASDOMAINNOTSUPPORTKEYLESS = "InvalidParameter.AliasDomainNotSupportKeyless"

	// Chinese SM certificates are not supported for alias domain names.
	INVALIDPARAMETER_ALIASDOMAINNOTSUPPORTSMCERT = "InvalidParameter.AliasDomainNotSupportSMCert"

	// The function content has a syntax error.
	INVALIDPARAMETER_BADCONTENT = "InvalidParameter.BadContent"

	// The function name does not meet specifications.
	INVALIDPARAMETER_BADFUNCTIONNAME = "InvalidParameter.BadFunctionName"

	// Invalid query string.
	INVALIDPARAMETER_CACHEKEYQUERYSTRINGREQUIRESFULLURLCACHEOFF = "InvalidParameter.CacheKeyQueryStringRequiresFullUrlCacheOff"

	// The query string has too many values.
	INVALIDPARAMETER_CACHEKEYQUERYSTRINGTOOMANYVALUE = "InvalidParameter.CacheKeyQueryStringTooManyValue"

	// Invalid edge HTTPS certificate configuration. The certificate does not match the domain name.
	INVALIDPARAMETER_CERTNOTMATCHDOMAIN = "InvalidParameter.CertNotMatchDomain"

	// Internal error.
	INVALIDPARAMETER_CERTSYSTEMERROR = "InvalidParameter.CertSystemError"

	// The edge HTTPS certificate is about to expire.
	INVALIDPARAMETER_CERTTOEXPIRE = "InvalidParameter.CertToExpire"

	// Invalid edge HTTPS certificate configuration. The key length does not meet the minimum requirement RSA>=2048, DSA>=2048, DH>=2048, and EC>=225.
	INVALIDPARAMETER_CERTTOOSHORTKEYSIZE = "InvalidParameter.CertTooShortKeySize"

	// The domain name to be changed is not bound to a certificate or keyless server. Please bind it first and then proceed.
	INVALIDPARAMETER_CERTIFICATECONFLICTWITHKEYLESSSERVER = "InvalidParameter.CertificateConflictWithKeylessServer"

	// IPv6 access conflicts with client IP geographical location.
	INVALIDPARAMETER_CLIENTIPCOUNTRYCONFLICTSWITHIPV6 = "InvalidParameter.ClientIpCountryConflictsWithIpv6"

	// Unable to apply for a wildcard certificate under CNAME mode.
	INVALIDPARAMETER_CNAMEWILDHOSTNOTALLOWAPPLYCERTIFICATE = "InvalidParameter.CnameWildHostNotAllowApplyCertificate"

	// Invalid compression algorithm.
	INVALIDPARAMETER_COMPRESSIONINVALIDALGORITHMS = "InvalidParameter.CompressionInvalidAlgorithms"

	// The origin cannot be the same as the domain name.
	INVALIDPARAMETER_CONFLICTHOSTORIGIN = "InvalidParameter.ConflictHostOrigin"

	// The function content exceeds the size limit.
	INVALIDPARAMETER_CONTENTEXCEEDSLIMIT = "InvalidParameter.ContentExceedsLimit"

	// The domain name does not exist or is not belong to this account.
	INVALIDPARAMETER_DOMAINNOTFOUND = "InvalidParameter.DomainNotFound"

	// Traffic scheduling is already enabled for the current domain name.
	INVALIDPARAMETER_DOMAINONTRAFFICSCHEDULING = "InvalidParameter.DomainOnTrafficScheduling"

	// Duplicate rules.
	INVALIDPARAMETER_DUPLICATERULE = "InvalidParameter.DuplicateRule"

	//
	INVALIDPARAMETER_EDGECLIENTCERTCHECKERROR = "InvalidParameter.EdgeClientCertCheckError"

	// The current conditions do not support the requested operation.
	INVALIDPARAMETER_ERRACTIONUNSUPPORTTARGET = "InvalidParameter.ErrActionUnsupportTarget"

	// Invalid operation.
	INVALIDPARAMETER_ERRINVALIDACTION = "InvalidParameter.ErrInvalidAction"

	// Invalid operation: Duplicate operation configuration.
	INVALIDPARAMETER_ERRINVALIDACTIONDUPLICATEACTION = "InvalidParameter.ErrInvalidActionDuplicateAction"

	// Invalid rule engine operation. The origin server IP cannot be a private network IP or loopback address.
	INVALIDPARAMETER_ERRINVALIDACTIONORIGINPRIVATEADDRESS = "InvalidParameter.ErrInvalidActionOriginPrivateAddress"

	// Invalid operation: Invalid parameter.
	INVALIDPARAMETER_ERRINVALIDACTIONPARAM = "InvalidParameter.ErrInvalidActionParam"

	// Invalid parameter "action".
	INVALIDPARAMETER_ERRINVALIDACTIONPARAMACTION = "InvalidParameter.ErrInvalidActionParamAction"

	// Invalid value type for the parameter "action".
	INVALIDPARAMETER_ERRINVALIDACTIONPARAMBADVALUETYPE = "InvalidParameter.ErrInvalidActionParamBadValueType"

	// Invalid parameter: Duplicate parameter names.
	INVALIDPARAMETER_ERRINVALIDACTIONPARAMDUPLICATENAME = "InvalidParameter.ErrInvalidActionParamDuplicateName"

	// Invalid value type for the parameter "action".
	INVALIDPARAMETER_ERRINVALIDACTIONPARAMNAME = "InvalidParameter.ErrInvalidActionParamName"

	// Invalid parameter: The parameter has too many values.
	INVALIDPARAMETER_ERRINVALIDACTIONPARAMTOOMANYVALUES = "InvalidParameter.ErrInvalidActionParamTooManyValues"

	// Invalid action.
	INVALIDPARAMETER_ERRINVALIDACTIONPARAMVALUE = "InvalidParameter.ErrInvalidActionParamValue"

	// Invalid action type.
	INVALIDPARAMETER_ERRINVALIDACTIONTYPE = "InvalidParameter.ErrInvalidActionType"

	// Invalid conditions.
	INVALIDPARAMETER_ERRINVALIDCONDITION = "InvalidParameter.ErrInvalidCondition"

	// The operations of modifying the origin server cannot be only to configure host matching type.
	INVALIDPARAMETER_ERRINVALIDCONDITIONCANNOTONLYCONTAINHOSTWHENMODIFYORIGINACTIONCONFIGURED = "InvalidParameter.ErrInvalidConditionCannotOnlyContainHostWhenModifyOriginActionConfigured"

	// You can only configure one host matching type when modifying the origin.
	INVALIDPARAMETER_ERRINVALIDCONDITIONHOSTTOOMANYWHENMODIFYORIGINACTIONCONFIGURED = "InvalidParameter.ErrInvalidConditionHostTooManyWhenModifyOriginActionConfigured"

	// Invalid condition: The letter case is ignored.
	INVALIDPARAMETER_ERRINVALIDCONDITIONIGNORECASE = "InvalidParameter.ErrInvalidConditionIgnoreCase"

	// Invalid condition: Invalid parameter name.
	INVALIDPARAMETER_ERRINVALIDCONDITIONNAMEBADNAME = "InvalidParameter.ErrInvalidConditionNameBadName"

	// Invalid condition: The match type is not supported by this parameter.
	INVALIDPARAMETER_ERRINVALIDCONDITIONNAMETARGETNOTSUPPORTNAME = "InvalidParameter.ErrInvalidConditionNameTargetNotSupportName"

	// Invalid condition: Invalid regular expression for the parameter value.
	INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADREGULAR = "InvalidParameter.ErrInvalidConditionValueBadRegular"

	// Invalid parameter value "url".
	INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADURL = "InvalidParameter.ErrInvalidConditionValueBadUrl"

	// Invalid condition: The parameter value is invalid.
	INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADVALUE = "InvalidParameter.ErrInvalidConditionValueBadValue"

	// Invalid parameter value: File extension is not allowed.
	INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADVALUECONTAINFILENAMEEXTENSION = "InvalidParameter.ErrInvalidConditionValueBadValueContainFileNameExtension"

	// Invalid condition: The parameter value exceeds the limit.
	INVALIDPARAMETER_ERRINVALIDCONDITIONVALUETOOLONGVALUE = "InvalidParameter.ErrInvalidConditionValueTooLongValue"

	// The condition has too many regular expressions.
	INVALIDPARAMETER_ERRINVALIDCONDITIONVALUETOOMANYREGULAR = "InvalidParameter.ErrInvalidConditionValueTooManyRegular"

	// Invalid condition: The parameter value exceeds the limit.
	INVALIDPARAMETER_ERRINVALIDCONDITIONVALUETOOMANYVALUES = "InvalidParameter.ErrInvalidConditionValueTooManyValues"

	// Invalid condition: Too many wildcards in the parameter.
	INVALIDPARAMETER_ERRINVALIDCONDITIONVALUETOOMANYWILDCARD = "InvalidParameter.ErrInvalidConditionValueTooManyWildcard"

	// Invalid condition: The parameter value is 0.
	INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEZEROLENGTH = "InvalidParameter.ErrInvalidConditionValueZeroLength"

	// ELSE is not supported for origin server modification.
	INVALIDPARAMETER_ERRINVALIDELSEWHENMODIFYORIGINACTIONCONFIGURED = "InvalidParameter.ErrInvalidElseWhenModifyOriginActionConfigured"

	// Empty condition.
	INVALIDPARAMETER_ERRNILCONDITION = "InvalidParameter.ErrNilCondition"

	// The function name conflicts with that of another function under this account.
	INVALIDPARAMETER_FUNCTIONNAMECONFLICT = "InvalidParameter.FunctionNameConflict"

	// To enable gRPC support, HTTP/2 support must be enabled as well.
	INVALIDPARAMETER_GRPCREQUIREHTTP2 = "InvalidParameter.GrpcRequireHttp2"

	// Host header error
	INVALIDPARAMETER_HOSTHEADERINVALID = "InvalidParameter.HostHeaderInvalid"

	// The domain name does not exist.
	INVALIDPARAMETER_HOSTNOTFOUND = "InvalidParameter.HostNotFound"

	// CNAME is not switched or the origin is not routed to the EdgeOne server.
	INVALIDPARAMETER_HOSTSTATUSNOTALLOWAPPLYCERTIFICATE = "InvalidParameter.HostStatusNotAllowApplyCertificate"

	// Parameter error.
	INVALIDPARAMETER_INVALIDACCELERATETYPE = "InvalidParameter.InvalidAccelerateType"

	// Invalid token authentication.
	INVALIDPARAMETER_INVALIDAUTHENTICATION = "InvalidParameter.InvalidAuthentication"

	// Invalid token authentication expiration time.
	INVALIDPARAMETER_INVALIDAUTHENTICATIONTYPEEXPIRETIME = "InvalidParameter.InvalidAuthenticationTypeExpireTime"

	// Invalid key for token authentication.
	INVALIDPARAMETER_INVALIDAUTHENTICATIONTYPESECRETKEY = "InvalidParameter.InvalidAuthenticationTypeSecretKey"

	// Invalid token authentication parameter.
	INVALIDPARAMETER_INVALIDAUTHENTICATIONTYPESIGNPARAM = "InvalidParameter.InvalidAuthenticationTypeSignParam"

	// Invalid authentication token format.
	INVALIDPARAMETER_INVALIDAUTHENTICATIONTYPETIMEFORMAT = "InvalidParameter.InvalidAuthenticationTypeTimeFormat"

	// Invalid authentication token parameter.
	INVALIDPARAMETER_INVALIDAUTHENTICATIONTYPETIMEPARAM = "InvalidParameter.InvalidAuthenticationTypeTimeParam"

	// The format of automatically used vouchers is incorrect. Enter the correct format.
	INVALIDPARAMETER_INVALIDAUTOUSEVOUCHER = "InvalidParameter.InvalidAutoUseVoucher"

	// Invalid third-party object storage.
	INVALIDPARAMETER_INVALIDAWSPRIVATEACCESS = "InvalidParameter.InvalidAwsPrivateAccess"

	// Invalid region. Please fill in a correct region of the third-party object storage service.
	INVALIDPARAMETER_INVALIDAWSREGION = "InvalidParameter.InvalidAwsRegion"

	// Invalid third-party object storage.
	INVALIDPARAMETER_INVALIDAWSSECRETKEY = "InvalidParameter.InvalidAwsSecretKey"

	// Invalid secondary origin domain.
	INVALIDPARAMETER_INVALIDBACKUPSERVERNAME = "InvalidParameter.InvalidBackupServerName"

	// Invalid node cache.
	INVALIDPARAMETER_INVALIDCACHECONFIGCACHE = "InvalidParameter.InvalidCacheConfigCache"

	// Invalid node cache. The origin behavior is followed.
	INVALIDPARAMETER_INVALIDCACHECONFIGFOLLOWORIGIN = "InvalidParameter.InvalidCacheConfigFollowOrigin"

	// Invalid cache key.
	INVALIDPARAMETER_INVALIDCACHEKEY = "InvalidParameter.InvalidCacheKey"

	// Invalid cache key cookie.
	INVALIDPARAMETER_INVALIDCACHEKEYCOOKIE = "InvalidParameter.InvalidCacheKeyCookie"

	// Cases are ignored in the cache key.
	INVALIDPARAMETER_INVALIDCACHEKEYIGNORECASE = "InvalidParameter.InvalidCacheKeyIgnoreCase"

	// Invalid query string.
	INVALIDPARAMETER_INVALIDCACHEKEYQUERYSTRINGACTION = "InvalidParameter.InvalidCacheKeyQueryStringAction"

	// Invalid query string.
	INVALIDPARAMETER_INVALIDCACHEKEYQUERYSTRINGVALUE = "InvalidParameter.InvalidCacheKeyQueryStringValue"

	// Invalid cache key scheme.
	INVALIDPARAMETER_INVALIDCACHEKEYSCHEME = "InvalidParameter.InvalidCacheKeyScheme"

	// Invalid node cache.
	INVALIDPARAMETER_INVALIDCACHEONLYONSWITCH = "InvalidParameter.InvalidCacheOnlyOnSwitch"

	// Invalid node cache validity.
	INVALIDPARAMETER_INVALIDCACHETIME = "InvalidParameter.InvalidCacheTime"

	// Invalid edge HTTPS certificate information.
	INVALIDPARAMETER_INVALIDCERTINFO = "InvalidParameter.InvalidCertInfo"

	// Invalid client IP location configuration. HeaderName consists of 1-100 alphanumeric characters and cannot start or end with hyphens (-).
	INVALIDPARAMETER_INVALIDCLIENTIPCOUNTRYHEADERNAME = "InvalidParameter.InvalidClientIpCountryHeaderName"

	// Invalid client IP request header.
	INVALIDPARAMETER_INVALIDCLIENTIPHEADERNAME = "InvalidParameter.InvalidClientIpHeaderName"

	// Invalid origin for region-specific origin-pull.
	INVALIDPARAMETER_INVALIDCLIENTIPORIGIN = "InvalidParameter.InvalidClientIpOrigin"

	// Invalid conditions.
	INVALIDPARAMETER_INVALIDCONDITIONS = "InvalidParameter.InvalidConditions"

	// Invalid origin-pull configuration. When `OriginType` is `COS` or `AWS_S3`, the origin address must be an object storage domain name.
	INVALIDPARAMETER_INVALIDCOSDOMAIN = "InvalidParameter.InvalidCosDomain"

	// Invalid smart acceleration.
	INVALIDPARAMETER_INVALIDDYNAMICROUTINE = "InvalidParameter.InvalidDynamicRoutine"

	// The package does not support Smart Acceleration.
	INVALIDPARAMETER_INVALIDDYNAMICROUTINEBILLING = "InvalidParameter.InvalidDynamicRoutineBilling"

	// Invalid custom error page.
	INVALIDPARAMETER_INVALIDERRORPAGE = "InvalidParameter.InvalidErrorPage"

	// Invalid custom error page.
	INVALIDPARAMETER_INVALIDERRORPAGEREDIRECTURL = "InvalidParameter.InvalidErrorPageRedirectUrl"

	// Invalid filter field.
	INVALIDPARAMETER_INVALIDFILTERNAME = "InvalidParameter.InvalidFilterName"

	// Invalid forced HTTPS direction settings
	INVALIDPARAMETER_INVALIDFORCEREDIRECTTYPE = "InvalidParameter.InvalidForceRedirectType"

	// Invalid parameter "https".
	INVALIDPARAMETER_INVALIDHTTPS = "InvalidParameter.InvalidHttps"

	// Invalid edge HTTPS certificate configuration. The certificate content is invalid.
	INVALIDPARAMETER_INVALIDHTTPSCERTINFO = "InvalidParameter.InvalidHttpsCertInfo"

	// The cipher suite does not match the TLS version.
	INVALIDPARAMETER_INVALIDHTTPSCIPHERSUITEANDTLSVERSION = "InvalidParameter.InvalidHttpsCipherSuiteAndTlsVersion"

	// Invalid HTTPS HSTS.
	INVALIDPARAMETER_INVALIDHTTPSHSTSMAXAGE = "InvalidParameter.InvalidHttpsHstsMaxAge"

	// Invalid HTTPS TLS version.
	INVALIDPARAMETER_INVALIDHTTPSTLSVERSION = "InvalidParameter.InvalidHttpsTlsVersion"

	// Invalid interval. The value should be either [min 5min hour day].
	INVALIDPARAMETER_INVALIDINTERVAL = "InvalidParameter.InvalidInterval"

	// Invalid IPv6 settings.
	INVALIDPARAMETER_INVALIDIPV6SWITCH = "InvalidParameter.InvalidIpv6Switch"

	// The field separator in the log output format is incorrect.
	INVALIDPARAMETER_INVALIDLOGFORMATFIELDDELIMITER = "InvalidParameter.InvalidLogFormatFieldDelimiter"

	// The log output format type is incorrect.
	INVALIDPARAMETER_INVALIDLOGFORMATFORMATTYPE = "InvalidParameter.InvalidLogFormatFormatType"

	// The log record separator in the log output format is incorrect.
	INVALIDPARAMETER_INVALIDLOGFORMATRECORDDELIMITER = "InvalidParameter.InvalidLogFormatRecordDelimiter"

	// Invalid browser cache.
	INVALIDPARAMETER_INVALIDMAXAGEFOLLOWORIGIN = "InvalidParameter.InvalidMaxAgeFollowOrigin"

	// Invalid browser cache.
	INVALIDPARAMETER_INVALIDMAXAGETIME = "InvalidParameter.InvalidMaxAgeTime"

	// The query dimension is invalid.
	INVALIDPARAMETER_INVALIDMETRIC = "InvalidParameter.InvalidMetric"

	// Invalid origin server.
	INVALIDPARAMETER_INVALIDORIGIN = "InvalidParameter.InvalidOrigin"

	// The origin server group type is incorrect.
	INVALIDPARAMETER_INVALIDORIGINGROUPTYPE = "InvalidParameter.InvalidOriginGroupType"

	// The origin cannot be a private IP or loopback address.
	INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"

	// Incorrect origin server type.
	INVALIDPARAMETER_INVALIDORIGINTYPE = "InvalidParameter.InvalidOriginType"

	// The origin server is incorrect or inexistent.
	INVALIDPARAMETER_INVALIDORIGINVALUE = "InvalidParameter.InvalidOriginValue"

	// Invalid parameter.
	INVALIDPARAMETER_INVALIDPARAMETER = "InvalidParameter.InvalidParameter"

	// The plan cycle format is incorrect. Enter the correct format.
	INVALIDPARAMETER_INVALIDPERIOD = "InvalidParameter.InvalidPeriod"

	// The plan type format is incorrect. Enter the correct format.
	INVALIDPARAMETER_INVALIDPLANTYPE = "InvalidParameter.InvalidPlanType"

	// The speciThe plan does not support limiting the max upload size.
	INVALIDPARAMETER_INVALIDPOSTMAXSIZEBILLING = "InvalidParameter.InvalidPostMaxSizeBilling"

	// Invalid POST request size.
	INVALIDPARAMETER_INVALIDPOSTSIZEVALUE = "InvalidParameter.InvalidPostSizeValue"

	// AccessKeyId and SecretAccessKey are required to access the third-party object storage.
	INVALIDPARAMETER_INVALIDPRIVATEACCESSPARAMS = "InvalidParameter.InvalidPrivateAccessParams"

	// The value of `PrivateAccess` should be `on` or `off`.
	INVALIDPARAMETER_INVALIDPRIVATEACCESSSWITCH = "InvalidParameter.InvalidPrivateAccessSwitch"

	// The plan does not support QUIC.
	INVALIDPARAMETER_INVALIDQUICBILLING = "InvalidParameter.InvalidQuicBilling"

	// The quota quantity format is incorrect. Enter the correct format.
	INVALIDPARAMETER_INVALIDQUOTANUMBER = "InvalidParameter.InvalidQuotaNumber"

	// The quota type format is incorrect. Enter the correct quota type format.
	INVALIDPARAMETER_INVALIDQUOTATYPE = "InvalidParameter.InvalidQuotaType"

	// Invalid Range GETs.
	INVALIDPARAMETER_INVALIDRANGEORIGINPULL = "InvalidParameter.InvalidRangeOriginPull"

	// The auto-renewal flag format is incorrect. Enter the correct format.
	INVALIDPARAMETER_INVALIDRENEWFLAG = "InvalidParameter.InvalidRenewFlag"

	// Invalid request header.
	INVALIDPARAMETER_INVALIDREQUESTHEADERNAME = "InvalidParameter.InvalidRequestHeaderName"

	// Invalid request header x-forwarded-for.
	INVALIDPARAMETER_INVALIDREQUESTHEADERNAMEXFF = "InvalidParameter.InvalidRequestHeaderNameXff"

	// Invalid request header.
	INVALIDPARAMETER_INVALIDREQUESTHEADERVALUE = "InvalidParameter.InvalidRequestHeaderValue"

	// You have not purchased a plan yet.
	INVALIDPARAMETER_INVALIDRESOURCEIDBILLING = "InvalidParameter.InvalidResourceIdBilling"

	// Invalid response header.
	INVALIDPARAMETER_INVALIDRESPONSEHEADERNAME = "InvalidParameter.InvalidResponseHeaderName"

	// Invalid response header.
	INVALIDPARAMETER_INVALIDRESPONSEHEADERVALUE = "InvalidParameter.InvalidResponseHeaderValue"

	// Invalid rule engine operation.
	INVALIDPARAMETER_INVALIDRULEENGINEACTION = "InvalidParameter.InvalidRuleEngineAction"

	// The rule does not exist.
	INVALIDPARAMETER_INVALIDRULEENGINENOTFOUND = "InvalidParameter.InvalidRuleEngineNotFound"

	// Invalid rule engine condition.
	INVALIDPARAMETER_INVALIDRULEENGINETARGET = "InvalidParameter.InvalidRuleEngineTarget"

	// Invalid file extension in the rule engine condition.
	INVALIDPARAMETER_INVALIDRULEENGINETARGETSEXTENSION = "InvalidParameter.InvalidRuleEngineTargetsExtension"

	// Invalid URL in the rule engine condition.
	INVALIDPARAMETER_INVALIDRULEENGINETARGETSURL = "InvalidParameter.InvalidRuleEngineTargetsUrl"

	// Incorrect protocol of the rules. (TCP/UDP).
	INVALIDPARAMETER_INVALIDRULEPROTO = "InvalidParameter.InvalidRuleProto"

	// Invalid origin domain.
	INVALIDPARAMETER_INVALIDSERVERNAME = "InvalidParameter.InvalidServerName"

	// Invalid debug configuration for EdgeOne.
	INVALIDPARAMETER_INVALIDSTANDARDDEBUG = "InvalidParameter.InvalidStandardDebug"

	// Invalid client IP or CIDR block.
	INVALIDPARAMETER_INVALIDSTANDARDDEBUGCLIENTIP = "InvalidParameter.InvalidStandardDebugClientIp"

	// The AllowClientIPList parameter is mandatory. The IPv4 and IPv6 network segments are supported. 0.0.0.0/0 indicates that all IPv4 clients can be debugged, and ::/0 indicates that all IPv6 clients can be debugged.
	INVALIDPARAMETER_INVALIDSTANDARDDEBUGEMPTYLIST = "InvalidParameter.InvalidStandardDebugEmptyList"

	// The expiration time is exceeded.
	INVALIDPARAMETER_INVALIDSTANDARDDEBUGEXPIRETIMELIMIT = "InvalidParameter.InvalidStandardDebugExpireTimeLimit"

	// Origin-pull request configuration error: Invalid query string.
	INVALIDPARAMETER_INVALIDUPSTREAMREQUESTQUERYSTRINGVALUE = "InvalidParameter.InvalidUpstreamRequestQueryStringValue"

	// Invalid URL rewrite.
	INVALIDPARAMETER_INVALIDURLREDIRECT = "InvalidParameter.InvalidUrlRedirect"

	// Invalid target host in the URL rewriting rule.
	INVALIDPARAMETER_INVALIDURLREDIRECTHOST = "InvalidParameter.InvalidUrlRedirectHost"

	// The target URL for URL rewrite is invalid.
	INVALIDPARAMETER_INVALIDURLREDIRECTURL = "InvalidParameter.InvalidUrlRedirectUrl"

	// Invalid WebSocket.
	INVALIDPARAMETER_INVALIDWEBSOCKETTIMEOUT = "InvalidParameter.InvalidWebSocketTimeout"

	// Invalid cache key.
	INVALIDPARAMETER_KEYRULESINVALIDQUERYSTRINGVALUE = "InvalidParameter.KeyRulesInvalidQueryStringValue"

	// Maximum parameter length exceeded.
	INVALIDPARAMETER_LENGTHEXCEEDSLIMIT = "InvalidParameter.LengthExceedsLimit"

	// The Cloud Load Balancer instance ID is required in the operation of modifying the origin server.
	INVALIDPARAMETER_LOADBALANCEINSTANCEIDISREQUIRED = "InvalidParameter.LoadBalanceInstanceIdIsRequired"

	// The Layer-4 proxy service referencing a LoadBalancer is being deployed. Please edit later.
	INVALIDPARAMETER_LOADBALANCERBINDL4NOTINSTABLESTATUS = "InvalidParameter.LoadBalancerBindL4NotInStableStatus"

	// The Layer-7 domain name service referencing a LoadBalancer is being deployed. Please edit later.
	INVALIDPARAMETER_LOADBALANCERBINDL7NOTINSTABLESTATUS = "InvalidParameter.LoadBalancerBindL7NotInStableStatus"

	// The LoadBalancer names under the same site should be unique.
	INVALIDPARAMETER_LOADBALANCERNAMEREPEATED = "InvalidParameter.LoadBalancerNameRepeated"

	// The LoadBalancer is used in a Layer-4 proxy.
	INVALIDPARAMETER_LOADBALANCERUSEDINL4PROXY = "InvalidParameter.LoadBalancerUsedInL4Proxy"

	// The LoadBalancer is used in a Layer-7 domain name.
	INVALIDPARAMETER_LOADBALANCERUSEDINL7DOMAIN = "InvalidParameter.LoadBalancerUsedInL7Domain"

	// The LoadBalancer is used in a rule engine.
	INVALIDPARAMETER_LOADBALANCERUSEDINRULEENGINE = "InvalidParameter.LoadBalancerUsedInRuleEngine"

	// Modification parameters are missing.
	INVALIDPARAMETER_MODIFYPARAMETERSMISSING = "InvalidParameter.ModifyParametersMissing"

	// Smart routing is not supported.
	INVALIDPARAMETER_MULTIPLYLAYERNOTSUPPORTSMARTROUTING = "InvalidParameter.MultiplyLayerNotSupportSmartRouting"

	// Unsupported preset variables exist.
	INVALIDPARAMETER_NOTSUPPORTTHISPRESET = "InvalidParameter.NotSupportThisPreset"

	// The domain name is configured to forward requests to the origin directly. iSmart Acceleration must be enabled.
	INVALIDPARAMETER_OCDIRECTORIGINREQUIRESSMARTROUTING = "InvalidParameter.OCDirectOriginRequiresSmartRouting"

	// The type of the origin server group does not match the LoadBalancer type.
	INVALIDPARAMETER_ORIGINGROUPTYPECANNOTMATCHLBTYPE = "InvalidParameter.OriginGroupTypeCanNotMatchLBType"

	// The origin address cannot be a private IP address.
	INVALIDPARAMETER_ORIGINISINNERIP = "InvalidParameter.OriginIsInnerIp"

	// The layer-4 proxy strictly prohibits mixing IPs and domain names.
	INVALIDPARAMETER_ORIGINL4RECORDIPV4MIXDOMAIN = "InvalidParameter.OriginL4RecordIPV4MixDomain"

	// Usage of multi-domain origin server is forbidden for layer-4 proxy.
	INVALIDPARAMETER_ORIGINL4RECORDMULTIDOMAIN = "InvalidParameter.OriginL4RecordMultiDomain"

	// The origin group name already exists.
	INVALIDPARAMETER_ORIGINNAMEEXISTS = "InvalidParameter.OriginNameExists"

	// The origin group ID is required.
	INVALIDPARAMETER_ORIGINORIGINGROUPIDISREQUIRED = "InvalidParameter.OriginOriginGroupIdIsRequired"

	// The return protocol is required in the operation of modifying the origin server.
	INVALIDPARAMETER_ORIGINPULLPROTOCOLISREQUIRED = "InvalidParameter.OriginPullProtocolIsRequired"

	// Incorrect origin server format.
	INVALIDPARAMETER_ORIGINRECORDFORMATERROR = "InvalidParameter.OriginRecordFormatError"

	// Weight value range: 0-100.
	INVALIDPARAMETER_ORIGINRECORDWEIGHTVALUE = "InvalidParameter.OriginRecordWeightValue"

	// The key format is incorrect.
	INVALIDPARAMETER_ORIGINTHIRDPARTYPARAMFORMATERROR = "InvalidParameter.OriginThirdPartyParamFormatError"

	// Parameter error: Invalid “End time”. The interval between the start and end time cannot exceed 7 days.
	INVALIDPARAMETER_PARAMETERERROR = "InvalidParameter.ParameterError"

	// The plan doesn’t exist.
	INVALIDPARAMETER_PLANNOTFOUND = "InvalidParameter.PlanNotFound"

	// Maximum upload size exceeded.
	INVALIDPARAMETER_POSTMAXSIZELIMITEXCEEDED = "InvalidParameter.PostMaxSizeLimitExceeded"

	// The instance name already exists.
	INVALIDPARAMETER_PROXYNAMEDUPLICATING = "InvalidParameter.ProxyNameDuplicating"

	// Instance name can contain 1 to 50 characters. The allowed characters are a to z, 0 to 9, and -. - cannot be registered alone or used continuously and cannot be placed at the beginning or the end.
	INVALIDPARAMETER_PROXYNAMENOTMATCHED = "InvalidParameter.ProxyNameNotMatched"

	// The push instance has been created.
	INVALIDPARAMETER_REALTIMELOGENTITYALREADYCREATED = "InvalidParameter.RealtimeLogEntityAlreadyCreated"

	// The log push region is invalid.
	INVALIDPARAMETER_REALTIMELOGINVALIDDELIVERYAREA = "InvalidParameter.RealtimeLogInvalidDeliveryArea"

	// The log push type is invalid.
	INVALIDPARAMETER_REALTIMELOGINVALIDLOGTYPE = "InvalidParameter.RealtimeLogInvalidLogType"

	// The real-time log delivery type is invalid.
	INVALIDPARAMETER_REALTIMELOGINVALIDTASKTYPE = "InvalidParameter.RealtimeLogInvalidTaskType"

	// The real-time log push task data exceeded the limit.
	INVALIDPARAMETER_REALTIMELOGNUMSEXCEEDLIMIT = "InvalidParameter.RealtimeLogNumsExceedLimit"

	// Invalid response header.
	INVALIDPARAMETER_RESPONSEHEADERCACHECONTROLNOTALLOWDELETE = "InvalidParameter.ResponseHeaderCacheControlNotAllowDelete"

	// Incorrect origin server information format of the rules.
	INVALIDPARAMETER_RULEORIGINFORMATERROR = "InvalidParameter.RuleOriginFormatError"

	// The origin of the rule does not support multiple domain names.
	INVALIDPARAMETER_RULEORIGINMULTIDOMAIN = "InvalidParameter.RuleOriginMultiDomain"

	// The origin port of the rule must be an integer.
	INVALIDPARAMETER_RULEORIGINPORTINTEGER = "InvalidParameter.RuleOriginPortInteger"

	// Invalid origin in the rule.
	INVALIDPARAMETER_RULEORIGINVALUEERROR = "InvalidParameter.RuleOriginValueError"

	// The rule port already exists.
	INVALIDPARAMETER_RULEPORTDUPLICATING = "InvalidParameter.RulePortDuplicating"

	// Incorrect port number segment of the rules.
	INVALIDPARAMETER_RULEPORTGROUP = "InvalidParameter.RulePortGroup"

	// The port number of the rules must be an integer.
	INVALIDPARAMETER_RULEPORTINTEGER = "InvalidParameter.RulePortInteger"

	// Invalid parameter.
	INVALIDPARAMETER_SECURITY = "InvalidParameter.Security"

	// Configuration parameter error.
	INVALIDPARAMETER_SETTINGINVALIDPARAM = "InvalidParameter.SettingInvalidParam"

	// Some bound origin server groups do not exist.
	INVALIDPARAMETER_SOMEORIGINGROUPNOTEXIST = "InvalidParameter.SomeOriginGroupNotExist"

	// Shield Space is not bound with an origin.
	INVALIDPARAMETER_SPACENOTBINDORIGIN = "InvalidParameter.SpaceNotBindOrigin"

	// Invalid status code in cache.
	INVALIDPARAMETER_STATUSCODECACHEINVALIDSTATUSCODE = "InvalidParameter.StatusCodeCacheInvalidStatusCode"

	// Resource error
	INVALIDPARAMETER_TARGET = "InvalidParameter.Target"

	// Failed to create the task
	INVALIDPARAMETER_TASKNOTGENERATED = "InvalidParameter.TaskNotGenerated"

	// Internal error.
	INVALIDPARAMETER_TASKSYSTEMERROR = "InvalidParameter.TaskSystemError"

	// TLS version is not continuous for HTTPS.
	INVALIDPARAMETER_TLSVERSIONNOTINSEQUENCE = "InvalidParameter.TlsVersionNotInSequence"

	// Too many filter values.
	INVALIDPARAMETER_TOOMANYFILTERVALUES = "InvalidParameter.TooManyFilterValues"

	// Too many filter items.
	INVALIDPARAMETER_TOOMANYFILTERS = "InvalidParameter.TooManyFilters"

	// Invalid file upload link.
	INVALIDPARAMETER_UPLOADURL = "InvalidParameter.UploadUrl"

	//
	INVALIDPARAMETER_UPSTREAMCLIENTCERTCHECKERROR = "InvalidParameter.UpstreamClientCertCheckError"

	// The site is already bound.
	INVALIDPARAMETER_ZONEHASBEENBOUND = "InvalidParameter.ZoneHasBeenBound"

	// The zone is not bound to a package.
	INVALIDPARAMETER_ZONEHASNOTBEENBOUNDTOPLAN = "InvalidParameter.ZoneHasNotBeenBoundToPlan"

	// The site is being upgraded. Changing is not supported. Please try again later.
	INVALIDPARAMETER_ZONEISGRAYPUBLISHING = "InvalidParameter.ZoneIsGrayPublishing"

	// To switch a site from connecting without a domain name to connecting via the CNAME, the site name is required.
	INVALIDPARAMETER_ZONENAMEISREQUIRED = "InvalidParameter.ZoneNameIsRequired"

	// The site does not exist.
	INVALIDPARAMETER_ZONENOTFOUND = "InvalidParameter.ZoneNotFound"

	// Invalid parameter value.
	INVALIDPARAMETERVALUE = "InvalidParameterValue"

	// The domain name for this zone has been banned.
	INVALIDPARAMETERVALUE_ACCESSBLACKLIST = "InvalidParameterValue.AccessBlacklist"

	//
	INVALIDPARAMETERVALUE_ALIASDOMAINNOTSUPPORTEDGEMTLS = "InvalidParameterValue.AliasDomainNotSupportEdgeMTLS"

	//
	INVALIDPARAMETERVALUE_ALIASDOMAINNOTSUPPORTUPSTREAMMTLS = "InvalidParameterValue.AliasDomainNotSupportUpstreamMTLS"

	//
	INVALIDPARAMETERVALUE_CERTIFICATEVERIFYCLIENTMUSTCA = "InvalidParameterValue.CertificateVerifyClientMustCa"

	//
	INVALIDPARAMETERVALUE_CERTIFICATEVERIFYCLIENTNEEDCERT = "InvalidParameterValue.CertificateVerifyClientNeedCert"

	//
	INVALIDPARAMETERVALUE_CERTIFICATEVERIFYUPSTREAMCLIENTMUSTRSAORECC = "InvalidParameterValue.CertificateVerifyUpstreamClientMustRSAorECC"

	//
	INVALIDPARAMETERVALUE_CERTIFICATEVERIFYUPSTREAMCLIENTMUSTSVR = "InvalidParameterValue.CertificateVerifyUpstreamClientMustSVR"

	//
	INVALIDPARAMETERVALUE_CERTIFICATEVERIFYUPSTREAMCLIENTNEEDCERT = "InvalidParameterValue.CertificateVerifyUpstreamClientNeedCert"

	//
	INVALIDPARAMETERVALUE_CLIENTCERTINFOQUOTALIMIT = "InvalidParameterValue.ClientCertInfoQuotaLimit"

	// It conflicts with existing records.
	INVALIDPARAMETERVALUE_CONFLICTRECORD = "InvalidParameterValue.ConflictRecord"

	// DNS records conflict with DNSSEC.
	INVALIDPARAMETERVALUE_CONFLICTWITHDNSSEC = "InvalidParameterValue.ConflictWithDNSSEC"

	//
	INVALIDPARAMETERVALUE_CONFLICTWITHDOMAIN = "InvalidParameterValue.ConflictWithDomain"

	// This DNS record conflicts with NS records.
	INVALIDPARAMETERVALUE_CONFLICTWITHNSRECORD = "InvalidParameterValue.ConflictWithNSRecord"

	// The host record cannot be the same as the record value.
	INVALIDPARAMETERVALUE_CONTENTSAMEASNAME = "InvalidParameterValue.ContentSameAsName"

	// The page content does not match the Content-Type.
	INVALIDPARAMETERVALUE_CONTENTTYPENOTMATCH = "InvalidParameterValue.ContentTypeNotMatch"

	// The specified domain name does not match the site.
	INVALIDPARAMETERVALUE_DOMAINNOTMATCHZONE = "InvalidParameterValue.DomainNotMatchZone"

	// Format mismatch.
	INVALIDPARAMETERVALUE_FORMATMISMATCH = "InvalidParameterValue.FormatMismatch"

	// Configuration parameter format mismatch.
	INVALIDPARAMETERVALUE_GENERALMISMATCH = "InvalidParameterValue.GeneralMismatch"

	// Contains invalid value.
	INVALIDPARAMETERVALUE_INCLUDEINVALIDVALUE = "InvalidParameterValue.IncludeInvalidValue"

	// The alias domain name is invalid. It must contain numerics, English characters, and hyphens, but hyphen is not allowed at the beginning or the end.
	INVALIDPARAMETERVALUE_INVALIDALIASDOMAINNAME = "InvalidParameterValue.InvalidAliasDomainName"

	// Invalid alias domain suffix. This domain is for internal usage and cannot be used as the alias domain.
	INVALIDPARAMETERVALUE_INVALIDALIASNAMESUFFIX = "InvalidParameterValue.InvalidAliasNameSuffix"

	// Incorrect DNS record.
	INVALIDPARAMETERVALUE_INVALIDDNSCONTENT = "InvalidParameterValue.InvalidDNSContent"

	// Incorrect DNS record name.
	INVALIDPARAMETERVALUE_INVALIDDNSNAME = "InvalidParameterValue.InvalidDNSName"

	// Invalid accelerated domain name. It can contain [0-9], [A-Z], [a-z] and [-]. It cannot start or end with "-".
	INVALIDPARAMETERVALUE_INVALIDDOMAINNAME = "InvalidParameterValue.InvalidDomainName"

	// Invalid domain name. Please check the status.
	INVALIDPARAMETERVALUE_INVALIDDOMAINSTATUS = "InvalidParameterValue.InvalidDomainStatus"

	// Invalid keyless server ID.
	INVALIDPARAMETERVALUE_INVALIDKEYLESSSERVERID = "InvalidParameterValue.InvalidKeylessServerId"

	// Incorrect DNS proxy
	INVALIDPARAMETERVALUE_INVALIDPROXYORIGIN = "InvalidParameterValue.InvalidProxyOrigin"

	// The tag value contains invalid characters.
	INVALIDPARAMETERVALUE_INVALIDTAGVALUE = "InvalidParameterValue.InvalidTagValue"

	// Missing required configuration parameters.
	INVALIDPARAMETERVALUE_MISSINGNECESSARYPARAM = "InvalidParameterValue.MissingNecessaryParam"

	// Wildcard domain CNAMEs are not supported.
	INVALIDPARAMETERVALUE_NOTALLOWEDWILDCARDSHAREDCNAME = "InvalidParameterValue.NotAllowedWildcardSharedCNAME"

	// The value is not within the required collection.
	INVALIDPARAMETERVALUE_NOTINENUMERATION = "InvalidParameterValue.NotInEnumeration"

	// The value is not within the specified range.
	INVALIDPARAMETERVALUE_NOTWITHINRANGE = "InvalidParameterValue.NotWithinRange"

	// The specified origin group does not exist.
	INVALIDPARAMETERVALUE_ORIGINGROUPNOTEXISTS = "InvalidParameterValue.OriginGroupNotExists"

	// The page name already exists.
	INVALIDPARAMETERVALUE_PAGENAMEALREADYEXIST = "InvalidParameterValue.PageNameAlreadyExist"

	// Does not match the specified regular expression.
	INVALIDPARAMETERVALUE_REGEXMISMATCH = "InvalidParameterValue.RegExMismatch"

	// Edge mTLS is enabled. When the client uses an RSA or ECC algorithm certificate, the same algorithm certificate should also be configured in the edge HTTPS certificate.
	INVALIDPARAMETERVALUE_SERVERCERTINFONEEDCONTAINRSAORECC = "InvalidParameterValue.ServerCertInfoNeedContainRSAorECC"

	// Edge mTLS is enabled. When the client uses a national encryption CA certificate, the national encryption certificate should also be configured in the edge HTTPS certificate.
	INVALIDPARAMETERVALUE_SERVERCERTINFONEEDCONTAINSM2 = "InvalidParameterValue.ServerCertInfoNeedContainSM2"

	// Enter a valid shared CNAME prefix of up to 50 characters.
	INVALIDPARAMETERVALUE_SHAREDCNAMEPREFIXNOTMATCH = "InvalidParameterValue.SharedCNAMEPrefixNotMatch"

	// The current domain suffix is not supported for access. Please contact us if you need to use it.
	INVALIDPARAMETERVALUE_TOPLEVELDOMAINNOTSUPPORT = "InvalidParameterValue.TopLevelDomainNotSupport"

	// Configuration item error.
	INVALIDPARAMETERVALUE_UNRECOGNIZABLEVALUE = "InvalidParameterValue.UnrecognizableValue"

	//
	INVALIDPARAMETERVALUE_UPSTREAMCLIENTCERTINFOQUOTALIMIT = "InvalidParameterValue.UpstreamClientCertInfoQuotaLimit"

	// The zone name format is incorrect. Please input a correctly formed domain name.
	INVALIDPARAMETERVALUE_ZONENAMEINVALID = "InvalidParameterValue.ZoneNameInvalid"

	// Punycode access is not supported at present.
	INVALIDPARAMETERVALUE_ZONENAMENOTSUPPORTPUNYCODE = "InvalidParameterValue.ZoneNameNotSupportPunyCode"

	// The zone does not support subdomain access. Please use second-level domains for zone access.
	INVALIDPARAMETERVALUE_ZONENAMENOTSUPPORTSUBDOMAIN = "InvalidParameterValue.ZoneNameNotSupportSubDomain"

	// The site alias already exists.
	INVALIDPARAMETERVALUE_ZONESAMEASNAME = "InvalidParameterValue.ZoneSameAsName"

	// The quota limit has been reached.
	LIMITEXCEEDED = "LimitExceeded"

	// Reached the upper limit of resource number
	LIMITEXCEEDED_BATCHQUOTA = "LimitExceeded.BatchQuota"

	// The number of regular expression type fields in real-time log custom fields exceeds the limit.
	LIMITEXCEEDED_CUSTOMLOGFIELDREGEXLIMITEXCEEDED = "LimitExceeded.CustomLogFieldRegexLimitExceeded"

	// Reached the daily upper limit of resource number
	LIMITEXCEEDED_DAILYQUOTA = "LimitExceeded.DailyQuota"

	// The number of functions has reached the limit.
	LIMITEXCEEDED_FUNCTIONLIMITEXCEEDED = "LimitExceeded.FunctionLimitExceeded"

	// The number of LoadBalancers exceeds the limit.
	LIMITEXCEEDED_LOADBALANCINGCOUNTLIMITEXCEEDED = "LimitExceeded.LoadBalancingCountLimitExceeded"

	// Not supported by the plan.
	LIMITEXCEEDED_PACKNOTALLOW = "LimitExceeded.PackNotAllow"

	// The number of rules imported has exceeded the limit.
	LIMITEXCEEDED_PROXYRULESLIMITEXCEEDED = "LimitExceeded.ProxyRulesLimitExceeded"

	// Query time limit exceeded.
	LIMITEXCEEDED_QUERYTIMELIMITEXCEEDED = "LimitExceeded.QueryTimeLimitExceeded"

	// Reached the API rate limit.
	LIMITEXCEEDED_RATELIMITEXCEEDED = "LimitExceeded.RateLimitExceeded"

	// The number of rules has reached the limit.
	LIMITEXCEEDED_RULELIMITEXCEEDED = "LimitExceeded.RuleLimitExceeded"

	// Limit exceeded
	LIMITEXCEEDED_SECURITY = "LimitExceeded.Security"

	// User instance quantity limitation.
	LIMITEXCEEDED_USERQUOTALIMITED = "LimitExceeded.UserQuotaLimited"

	// Reached the upper limit of sites of the plan
	LIMITEXCEEDED_ZONEBINDPLAN = "LimitExceeded.ZoneBindPlan"

	// Missing parameters.
	MISSINGPARAMETER = "MissingParameter"

	// Operation denied.
	OPERATIONDENIED = "OperationDenied"

	// Cross-MLC-border acceleration is in beta. To join the beta, submit a ticket.
	OPERATIONDENIED_ACCELERATEMAINLANDDISABLE = "OperationDenied.AccelerateMainlandDisable"

	// Cross-MLC-border acceleration and IPv6 cannot be configured at the same time.
	OPERATIONDENIED_ACCELERATEMAINLANDIPV6CONFLICT = "OperationDenied.AccelerateMainlandIpv6Conflict"

	// The existing domain feature under the current site conflicts with the Chinese mainland network optimization, and cannot be configured at the same time.
	OPERATIONDENIED_ACCELERATEMAINLANDMULTIPLYLAYERCONFLICT = "OperationDenied.AccelerateMainlandMultiplyLayerConflict"

	// An L7 DNS service referencing the origin group is being deployed. Please edit later.
	OPERATIONDENIED_ACCELERATIONDOMAINSTATUSNOTINONLINE = "OperationDenied.AccelerationDomainStatusNotInOnline"

	// Currently, only the keyless certificate mode allows the private key of the certificate to be empty.
	OPERATIONDENIED_CERTIFICATEPRIVATEKEYISEMPTY = "OperationDenied.CertificatePrivateKeyIsEmpty"

	// The current compliance status is banning.
	OPERATIONDENIED_COMPLIANCEFORBIDDEN = "OperationDenied.ComplianceForbidden"

	// The configuration is locked. Please unlock and try again.
	OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"

	// The TEO_QCSLinkedRoleInDnspodAccessEO role is not authorized. Please authorize it and try again.
	OPERATIONDENIED_DNSPODUNAUTHORIZEDROLEOPERATION = "OperationDenied.DNSPodUnauthorizedRoleOperation"

	// The pre-check failed during site deletion.
	OPERATIONDENIED_DELETEZONEPRECHECKFAILED = "OperationDenied.DeleteZonePreCheckFailed"

	// The EdgeOne service of the site is being disabled. Please try again later.
	OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"

	// Switch failed: There are domain names in the shared CNAME group.
	OPERATIONDENIED_DOMAININSHARECNAMEGROUP = "OperationDenied.DomainInShareCnameGroup"

	// Unable to use the domain name when it’s blocked.
	OPERATIONDENIED_DOMAINISBLOCKED = "OperationDenied.DomainIsBlocked"

	// The domain name doesn't have an ICP filing number.
	OPERATIONDENIED_DOMAINNOICP = "OperationDenied.DomainNoICP"

	// Unable to modify the service area: There are domain names under the site.
	OPERATIONDENIED_DOMAINNUMBERISNOTZERO = "OperationDenied.DomainNumberIsNotZero"

	// Some domain names on the site are currently experiencing instability. The stable states for domain names are "online" and "offline".
	OPERATIONDENIED_DOMAINSTATUSUNSTABLE = "OperationDenied.DomainStatusUnstable"

	// The Enterprise Edition Plan does not support auto-renewal.
	OPERATIONDENIED_ENTERPRISEPLANAUTORENEWUNSUPPORTED = "OperationDenied.EnterprisePlanAutoRenewUnsupported"

	// The Enterprise Edition Plan does not support renewal.
	OPERATIONDENIED_ENTERPRISEPLANRENEWUNSUPPORTED = "OperationDenied.EnterprisePlanRenewUnsupported"

	// The Enterprise Edition Plan does not support upgrades.
	OPERATIONDENIED_ENTERPRISEPLANUPGRADEUNSUPPORTED = "OperationDenied.EnterprisePlanUpgradeUnsupported"

	// The site environment is not ready.
	OPERATIONDENIED_ENVNOTREADY = "OperationDenied.EnvNotReady"

	// The EdgeOne service of the site is disabled. Please enable it and try again.
	OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"

	//
	OPERATIONDENIED_HOSTSCLIENTCERTIFICATEINCONSISTENCY = "OperationDenied.HostsClientCertificateInconsistency"

	// The keyless server of the domain name to be changed is inconsistent. Please confirm that the keyless server is consistent before retrying.
	OPERATIONDENIED_HOSTSKEYLESSSERVERINCONSISTENCY = "OperationDenied.HostsKeylessServerInconsistency"

	//
	OPERATIONDENIED_HOSTSUPSTREAMCERTIFICATEINCONSISTENCY = "OperationDenied.HostsUpstreamCertificateInconsistency"

	// The security service must be enabled when you enable the DDoS Protection.
	OPERATIONDENIED_INVALIDADVANCEDDEFENSESECURITYTYPE = "OperationDenied.InvalidAdvancedDefenseSecurityType"

	// The acceleration regions of the site must be in the Chinese mainland when you enable the DDoS Protection.
	OPERATIONDENIED_INVALIDADVANCEDDEFENSEZONEAREA = "OperationDenied.InvalidAdvancedDefenseZoneArea"

	// Exclusive DDoS protection conflicts with IPv6. They cannot be configured at the same time.
	OPERATIONDENIED_IPV6ADVANCEDCONFLICT = "OperationDenied.Ipv6AdvancedConflict"

	// The IPv6 feature and static IP cannot be enabled at the same time.
	OPERATIONDENIED_IPV6STATICIPCONFLICT = "OperationDenied.Ipv6StaticIpConflict"

	// The domain name to be changed has a different certificate or keyless server. Please confirm that the edge HTTPS certificate or keyless server is consistent before retrying.
	OPERATIONDENIED_KEYLESSCERTSWITCHTOFREECERTCONFLICT = "OperationDenied.KeylessCertSwitchToFreeCertConflict"

	// The keyless certificate mode requires the private key of the certificate to be empty.
	OPERATIONDENIED_KEYLESSMODECERTIFICATEPRIVATEKEYNEEDEMPTY = "OperationDenied.KeylessModeCertificatePrivateKeyNeedEmpty"

	// The layer-4 instance resource sales are skyrocketing and now the resources are sold out. Replenishing is in progress. Currently, new layer-4 proxies cannot be added. Please wait.
	OPERATIONDENIED_L4LACKOFRESOURCES = "OperationDenied.L4LackOfResources"

	// The sale of Layer 4 port resources is booming and they have been sold out. We are urgently restocking. At present, it is not possible to add new Layer 4 proxies or rules, and we kindly ask for your patience.
	OPERATIONDENIED_L4PORTLACKOFRESOURCES = "OperationDenied.L4PortLackOfResources"

	// Operation failed: The L4 proxy is blocked.
	OPERATIONDENIED_L4PROXYINBANNEDSTATUS = "OperationDenied.L4ProxyInBannedStatus"

	// The Layer 4 channel is closed and rule addition is disallowed.
	OPERATIONDENIED_L4PROXYINOFFLINESTATUS = "OperationDenied.L4ProxyInOfflineStatus"

	// The instance is currently in deployment and cannot be operated.
	OPERATIONDENIED_L4PROXYINPROCESSSTATUS = "OperationDenied.L4ProxyInProcessStatus"

	// The EdgeOne service cannot be disabled for the site: A L4 proxy instance is being deployed.
	OPERATIONDENIED_L4PROXYINPROGRESSSTATUS = "OperationDenied.L4ProxyInProgressStatus"

	// Unable to disable the site: There are L4 proxy instances disabled.
	OPERATIONDENIED_L4PROXYINSTOPPINGSTATUS = "OperationDenied.L4ProxyInStoppingStatus"

	// Unable to operate the L4 instance when it’s not running
	OPERATIONDENIED_L4STATUSNOTINONLINE = "OperationDenied.L4StatusNotInOnline"

	// The EdgeOne service cannot be disabled for the site: An accelerated domain name is being deployed.
	OPERATIONDENIED_L7HOSTINPROCESSSTATUS = "OperationDenied.L7HostInProcessStatus"

	// The affiliated Cloud Load Balancer is not in a running state. Operation is forbidden.
	OPERATIONDENIED_LOADBALANCESTATUSNOTINONLINE = "OperationDenied.LoadBalanceStatusNotInOnline"

	// The site status does not support operations on load balancers.
	OPERATIONDENIED_LOADBALANCINGZONEISNOTACTIVE = "OperationDenied.LoadBalancingZoneIsNotActive"

	// IPv6 cannot be enabled for non-overseas exclusive protection.
	OPERATIONDENIED_MSGIPV6ADVANCEDCONFLICT = "OperationDenied.MsgIpv6AdvancedConflict"

	// Unable to switch to NS for multiple sites using CNAME.
	OPERATIONDENIED_MULTIPLECNAMEZONE = "OperationDenied.MultipleCnameZone"

	// Domain traffic scheduling is not supported in NS access mode.
	OPERATIONDENIED_NSNOTALLOWTRAFFICSTRATEGY = "OperationDenied.NSNotAllowTrafficStrategy"

	// You can only switch a site connected without a domain name to connecting via the CNAME
	OPERATIONDENIED_NODOMAINACCESSZONEONLYALLOWMODIFIEDTOCNAME = "OperationDenied.NoDomainAccessZoneOnlyAllowModifiedToCNAME"

	// You can only switch a site connected without a domain name to connecting via the CNAME. Other operations are not allowed.
	OPERATIONDENIED_NODOMAINACCESSZONEONLYSUPPORTMODIFYTYPE = "OperationDenied.NoDomainAccessZoneOnlySupportModifyType"

	// Currently, the keyless certificate feature is available only to users in the allowlist.
	OPERATIONDENIED_NOTINKEYLESSWHITELIST = "OperationDenied.NotInKeylessWhiteList"

	//
	OPERATIONDENIED_NOTINUPSTREAMMTLSWHITELIST = "OperationDenied.NotInUpstreamMTLSWhiteList"

	// The current user is not included in the whitelist for version management.
	OPERATIONDENIED_NOTINVERSIONCONTROLWHITELIST = "OperationDenied.NotInVersionControlWhiteList"

	// Failed to delete: The acceleration domain name is in use.
	OPERATIONDENIED_ORIGINGROUPACCELERATIONDOMAINUSED = "OperationDenied.OriginGroupAccelerationDomainUsed"

	// The Layer 4 proxy is in use and cannot be deleted.
	OPERATIONDENIED_ORIGINGROUPL4USED = "OperationDenied.OriginGroupL4Used"

	// The Cloud Load Balancer is in use and cannot be deleted.
	OPERATIONDENIED_ORIGINGROUPLBUSED = "OperationDenied.OriginGroupLBUsed"

	// The rule engine is in use and cannot be deleted.
	OPERATIONDENIED_ORIGINGROUPRULEENGINEUSED = "OperationDenied.OriginGroupRuleEngineUsed"

	// Ownership verification failed. Please complete the site ownership verification first.
	OPERATIONDENIED_OWNERSHIPVERIFICATIONNOTPASSED = "OperationDenied.OwnershipVerificationNotPassed"

	// A plan downgrade is not supported.
	OPERATIONDENIED_PLANDOWNGRADENOTALLOWED = "OperationDenied.PlanDowngradeNotAllowed"

	// The plan has expired.
	OPERATIONDENIED_PLANHASBEENEXPIRED = "OperationDenied.PlanHasBeenExpired"

	// The plan has been isolated.
	OPERATIONDENIED_PLANHASBEENISOLATED = "OperationDenied.PlanHasBeenIsolated"

	// This plan does not support the purchase of additional plan quotas.
	OPERATIONDENIED_PLANINCREASEPLANQUOTAUNSUPPORTED = "OperationDenied.PlanIncreasePlanQuotaUnsupported"

	// The specified plan does not support changing the service area of the site.
	OPERATIONDENIED_PLANNOTSUPPORTMODIFYZONEAREA = "OperationDenied.PlanNotSupportModifyZoneArea"

	// This site is using Anycast IP scheduling mode and does not support Cross-MLC-border acceleration.
	OPERATIONDENIED_PLATTYPEIPACCELERATEMAINLANDNOTSUPPORT = "OperationDenied.PlatTypeIPAccelerateMainlandNotSupport"

	// To create an Enterprise Edition Plan, contact the business personnel.
	OPERATIONDENIED_PLEASECONTACTBUSINESSPERSONNEL = "OperationDenied.PleaseContactBusinessPersonnel"

	// The DNS record cannot be added.
	OPERATIONDENIED_RECORDISFORBIDDEN = "OperationDenied.RecordIsForbidden"

	// Billing resources are in operation. Try again later.
	OPERATIONDENIED_RESOURCEHASBEENLOCKED = "OperationDenied.ResourceHasBeenLocked"

	// This operation conflicts with concurrent operations. Try again later.
	OPERATIONDENIED_RESOURCELOCKEDTEMPORARY = "OperationDenied.ResourceLockedTemporary"

	// The domain name is bound with a shared CNAME and cannot be changed to "Cross-MLC-border acceleration". Please unbind the domain name from the shared CNAME first.
	OPERATIONDENIED_SHAREDCNAMEUNSUPPORTEDACCELERATEMAINLAND = "OperationDenied.SharedCNAMEUnsupportedAccelerateMainland"

	// The domain name is bound with a shared CNAME and cannot be changed to "IPv6 access". Please unbind the domain name from the shared CNAME first.
	OPERATIONDENIED_SHAREDCNAMEUNSUPPORTEDIPV6 = "OperationDenied.SharedCNAMEUnsupportedIPv6"

	// The static IP cannot be enabled for this instance's region.
	OPERATIONDENIED_STATICIPAREACONFLICT = "OperationDenied.StaticIpAreaConflict"

	//
	OPERATIONDENIED_UNSUPPORTTOCLOSEUPSTREAMMTLS = "OperationDenied.UnSupportToCloseUpstreamMTLS"

	//
	OPERATIONDENIED_USEUPSTREAMMTLSNEEDOPENHTTPS = "OperationDenied.UseUpstreamMTLSNeedOpenHttps"

	// There is a test version in use. Please release the test version to the live environment, or roll back the test version and try again.
	OPERATIONDENIED_VERSIONCONTROLISGRAYING = "OperationDenied.VersionControlIsGraying"

	// The operation is not allowed because the version management mode is applied.
	OPERATIONDENIED_VERSIONCONTROLLOCKED = "OperationDenied.VersionControlLocked"

	// The specified site working mode is not applicable to the version management mode.
	OPERATIONDENIED_WORKMODENOTINVERSIONCONTROL = "OperationDenied.WorkModeNotInVersionControl"

	// The shared CNAME has been bound to another site. Please unbind first.
	OPERATIONDENIED_ZONEISBINDINGSHAREDCNAME = "OperationDenied.ZoneIsBindingSharedCNAME"

	// Error found in the associated custom error page. Please unbind it first.
	OPERATIONDENIED_ZONEISREFERENCECUSTOMERRORPAGE = "OperationDenied.ZoneIsReferenceCustomErrorPage"

	// The zone is disabled.
	OPERATIONDENIED_ZONENOTACTIVE = "OperationDenied.ZoneNotActive"

	// The resource is occupied.
	RESOURCEINUSE = "ResourceInUse"

	// Resources occupied by the alias domain names under this account.
	RESOURCEINUSE_ALIASDOMAIN = "ResourceInUse.AliasDomain"

	// The alias domain name already exists.
	RESOURCEINUSE_ALIASNAME = "ResourceInUse.AliasName"

	// Resources occupied by this account via CNAME.
	RESOURCEINUSE_CNAME = "ResourceInUse.Cname"

	// DNS resources occupied.
	RESOURCEINUSE_DNS = "ResourceInUse.Dns"

	// The domain name is being resolved. If you need to enable acceleration, please go to DNS Records.
	RESOURCEINUSE_DNSRECORD = "ResourceInUse.DnsRecord"

	// Duplicate alias domain names.
	RESOURCEINUSE_DUPLICATENAME = "ResourceInUse.DuplicateName"

	// Resources occupied by the wildcard domain name.
	RESOURCEINUSE_GENERICHOST = "ResourceInUse.GenericHost"

	// Resources occupied by the subdomain names under this account.
	RESOURCEINUSE_HOST = "ResourceInUse.Host"

	// Resources occupied by this account via NS.
	RESOURCEINUSE_NS = "ResourceInUse.NS"

	// The resource has been connected to EdgeOne by another user.
	RESOURCEINUSE_OTHERS = "ResourceInUse.Others"

	// Resources occupied by the alias domain names under other accounts.
	RESOURCEINUSE_OTHERSALIASDOMAIN = "ResourceInUse.OthersAliasDomain"

	// Resources occupied by other accounts via CNAME.
	RESOURCEINUSE_OTHERSCNAME = "ResourceInUse.OthersCname"

	// Resources occupied by the subdomain names under other accounts.
	RESOURCEINUSE_OTHERSHOST = "ResourceInUse.OthersHost"

	// Resources occupied by other accounts via NS.
	RESOURCEINUSE_OTHERSNS = "ResourceInUse.OthersNS"

	// Resources occupied by this account and others via CNAME.
	RESOURCEINUSE_SELFANDOTHERSCNAME = "ResourceInUse.SelfAndOthersCname"

	// Unable to delete the shared CNAME: It is bound to an acceleration domain name. Please remove the binding first.
	RESOURCEINUSE_SHAREDCNAME = "ResourceInUse.SharedCNAME"

	// The alias domain name is already added.
	RESOURCEINUSE_ZONE = "ResourceInUse.Zone"

	// Insufficient resource.
	RESOURCEINSUFFICIENT = "ResourceInsufficient"

	// The resource doesn’t exist.
	RESOURCENOTFOUND = "ResourceNotFound"

	// The domain name is not properly accessed via DNSPod. Please try again after DNSPod access.
	RESOURCENOTFOUND_DNSPODDOMAINNOTINACCOUNT = "ResourceNotFound.DNSPodDomainNotInAccount"

	// Maximum upload size is not configured.
	RESOURCENOTFOUND_POSTMAXSIZEQUOTANOTFOUND = "ResourceNotFound.PostMaxSizeQuotaNotFound"

	// The configuration group version does not exist. Please check and try again.
	RESOURCENOTFOUND_VERSIONNOTFOUND = "ResourceNotFound.VersionNotFound"

	// The resource is unavailable.
	RESOURCEUNAVAILABLE = "ResourceUnavailable"

	// The certificate does not exist or is not authorized.
	RESOURCEUNAVAILABLE_CERTNOTFOUND = "ResourceUnavailable.CertNotFound"

	// The domain name is already connected to EdgeOne by another account. Please retrieve it first in order to add it.
	RESOURCEUNAVAILABLE_DOMAINALREADYEXISTS = "ResourceUnavailable.DomainAlreadyExists"

	// The requested accelerated domain name doesn’t exist.
	RESOURCEUNAVAILABLE_DOMAINNOTFOUND = "ResourceUnavailable.DomainNotFound"

	// The function does not exist or does not belong to this account.
	RESOURCEUNAVAILABLE_FUNCTIONNOTFOUND = "ResourceUnavailable.FunctionNotFound"

	// The domain name does not exist or not use a proxy.
	RESOURCEUNAVAILABLE_HOSTNOTFOUND = "ResourceUnavailable.HostNotFound"

	// The rule does not exist or does not belong to the account.
	RESOURCEUNAVAILABLE_RULENOTFOUND = "ResourceUnavailable.RuleNotFound"

	// The shared CNAME is used by others.
	RESOURCEUNAVAILABLE_SHAREDCNAMEALREADYEXISTS = "ResourceUnavailable.SharedCNAMEAlreadyExists"

	// The site does not exist or is not belong to this account.
	RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

	//
	RESOURCESSOLDOUT_L7LACKOFRESOURCES = "ResourcesSoldOut.L7LackOfResources"

	// Unauthorized operation.
	UNAUTHORIZEDOPERATION = "UnauthorizedOperation"

	// CAM is not authorized.
	UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

	// Authentication error.
	UNAUTHORIZEDOPERATION_DOMAINEMPTY = "UnauthorizedOperation.DomainEmpty"

	// The sub-account is not authorized for the operation. Please get permissions first.
	UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"

	// An unknown error occurred in the backend server.
	UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

	// Unsupported operation.
	UNSUPPORTEDOPERATION = "UnsupportedOperation"

	// The origin type of the target domain cannot be COS for an alias domain.
	UNSUPPORTEDOPERATION_TARGETNAMEORIGINTYPECOS = "UnsupportedOperation.TargetNameOriginTypeCos"
)
View Source 
const APIVersion = "2022-09-01"

Variables

This section is empty.

Functions

This section is empty.

Types

type AccelerateMainland 

type AccelerateMainland struct {
	// Whether to enable Cross-MLC-border acceleration. Valid values:
	// <li>`on`: Enable;</li>
	// <li>`off`: Disable.</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`
}

type AccelerateType 

type AccelerateType struct {
	// Acceleration switch. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`
}

type AccelerationDomain 

type AccelerationDomain struct {
	// ID of the site.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Accelerated domain name
	DomainName *string `json:"DomainName,omitnil,omitempty" name:"DomainName"`

	// Status of the accelerated domain name. Values:
	// <li>`online`: Activated</li>
	// <li>`process`: Being deployed</li>
	// <li>`offline`: Disabled</li>
	// <li>`forbidden`: Blocked</li>
	// <li>`init`: Pending activation</li>
	DomainStatus *string `json:"DomainStatus,omitnil,omitempty" name:"DomainStatus"`

	// Details of the origin.
	// Note: This field may return null, indicating that no valid values can be obtained.
	OriginDetail *OriginDetail `json:"OriginDetail,omitnil,omitempty" name:"OriginDetail"`

	// Origin-pull protocol configuration. Values:
	// <li>`FOLLOW`: Follow the protocol of origin</li>
	// <li>`HTTP`: Send requests to the origin over HTTP</li>
	// <li>`HTTPS`: Send requests to the origin over HTTPS</li>
	// Note: This field may return·null, indicating that no valid values can be obtained.
	OriginProtocol *string `json:"OriginProtocol,omitnil,omitempty" name:"OriginProtocol"`

	// The port used for HTTP origin-pull requests
	// Note: This field may return·null, indicating that no valid values can be obtained.
	HttpOriginPort *uint64 `json:"HttpOriginPort,omitnil,omitempty" name:"HttpOriginPort"`

	// The port used for HTTPS origin-pull requests
	// Note: This field may return·null, indicating that no valid values can be obtained.
	HttpsOriginPort *uint64 `json:"HttpsOriginPort,omitnil,omitempty" name:"HttpsOriginPort"`

	// IPv6 status. Values:
	// <li>`follow`: Follow the IPv6 configuration of the site</li>
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	// Note: This field may return·null, indicating that no valid values can be obtained.
	IPv6Status *string `json:"IPv6Status,omitnil,omitempty" name:"IPv6Status"`

	// The CNAME address.
	Cname *string `json:"Cname,omitnil,omitempty" name:"Cname"`

	// Ownership verification status. Values: <li>`pending`: Pending verification</li> <li>`finished`: Verified</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	IdentificationStatus *string `json:"IdentificationStatus,omitnil,omitempty" name:"IdentificationStatus"`

	// Creation time of the accelerated domain name.
	CreatedOn *string `json:"CreatedOn,omitnil,omitempty" name:"CreatedOn"`

	// Modification time of the accelerated domain name.
	ModifiedOn *string `json:"ModifiedOn,omitnil,omitempty" name:"ModifiedOn"`

	// Information required to verify the ownership of a domain name.
	// Note: This field may return·null, indicating that no valid values can be obtained.
	OwnershipVerification *OwnershipVerification `json:"OwnershipVerification,omitnil,omitempty" name:"OwnershipVerification"`

	// Domain name certificate information
	// Note: This field may return·null, indicating that no valid values can be obtained.
	Certificate *AccelerationDomainCertificate `json:"Certificate,omitnil,omitempty" name:"Certificate"`
}

type AccelerationDomainCertificate 

type AccelerationDomainCertificate struct {
	// Certificate configuration mode. Values: <li>`disable`: Do not configure the certificate;</li><li>`eofreecert`: Use a free certificate provided by EdgeOne; </li><li>`sslcert`: Configure an SSL certificate.</li>
	Mode *string `json:"Mode,omitnil,omitempty" name:"Mode"`

	// List of certificates
	// Note: This field may return·null, indicating that no valid values can be obtained.
	List []*CertificateInfo `json:"List,omitnil,omitempty" name:"List"`
}

type AclCondition 

type AclCondition struct {
	// Filters:
	// <li>`host`: Request domain name;</li>
	// <li>`sip`: Client IP;</li>
	// <li>`ua`: User-Agent;</li>
	// <li>`cookie`: Cookie;</li>
	// <li>`cgi`: CGI script;</li>
	// <li>`xff`: XFF header;</li></li>
	// <li>`url`: Request URL;<li></li>
	// <li>`accept`: Request content type;</li>
	// <li>`method`: Request method<;/li>
	// <li>`header`: Request header;</li>
	// <li>`app_proto`: Application layer protocol;</li>
	// <li>`sip_proto`: Network layer protocol;</li>
	// <li>`uabot`: UA rules (only available in custom bot rules);</li>
	// <li>`idcid`: IDC rules (only available in custom bot rules);</li>
	// <li>`sipbot`: Search engine rules (only available in custom bot rules);</li>
	// <li>`portrait`: Client reputation (only available in custom bot rules);</li>
	// <li>`header_seq`: Header sequence (only available in custom bot rules);</li>
	// <li>`hdr`: Request body (only available in custom Web protection rules). </li>
	MatchFrom *string `json:"MatchFrom,omitnil,omitempty" name:"MatchFrom"`

	// The parameter of the field. When `MatchFrom = header`, the key contained in the header can be passed.
	MatchParam *string `json:"MatchParam,omitnil,omitempty" name:"MatchParam"`

	// The logical operator. Values:
	// <li>`equal`: Value equals</li>
	// <li>`not_equal`: Value not equals</li>
	// <li>`include`: String contains</li>
	// <li>`not_include`: String not contains</li>
	// <li>`match`: IP matches</li>
	// <li>`not_match`: IP not matches</li>
	// <li>`include_area`: Regions contain</li>
	// <li>`is_empty`: Value left empty</li>
	// <li>`not_exists`: Key fields not exist</li>
	// <li>`regexp`: Regex matches</li>
	// <li>`len_gt`: Value greater than</li>
	// <li>`len_lt`: Value smaller than</li>
	// <li>`len_eq`: Value equals</li>
	// <li>`match_prefix`: Prefix matches</li>
	// <li>`match_suffix`: Suffix matches</li>
	// <li>`wildcard`: Wildcard</li>
	Operator *string `json:"Operator,omitnil,omitempty" name:"Operator"`

	// The content to match.
	MatchContent *string `json:"MatchContent,omitnil,omitempty" name:"MatchContent"`
}

type AclConfig 

type AclConfig struct {
	// Switch. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// The custom rule.
	AclUserRules []*AclUserRule `json:"AclUserRules,omitnil,omitempty" name:"AclUserRules"`

	// Custom managed rules
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	Customizes []*AclUserRule `json:"Customizes,omitnil,omitempty" name:"Customizes"`
}

type AclUserRule 

type AclUserRule struct {
	// The rule name.
	RuleName *string `json:"RuleName,omitnil,omitempty" name:"RuleName"`

	// The action. Values:
	// <li>`trans`: Allow</li>
	// <li>`drop`: Block the request</li>
	// <li>`monitor`: Observe</li>
	// <li>`ban`: Block the IP</li>
	// <li>`redirect`: Redirect the request</li>
	// <li>`page`: Return the specified page</li>
	// <li>`alg`: JavaScript challenge</li>
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`

	// The rule status. Values:
	// <li>`on`: Enabled</li>
	// <li>`off`: Disabled</li>
	RuleStatus *string `json:"RuleStatus,omitnil,omitempty" name:"RuleStatus"`

	// The custom rule.
	AclConditions []*AclCondition `json:"AclConditions,omitnil,omitempty" name:"AclConditions"`

	// The rule priority. Value range: 0-100.
	RulePriority *int64 `json:"RulePriority,omitnil,omitempty" name:"RulePriority"`

	// Rule ID, which is only used as an output parameter.
	RuleID *int64 `json:"RuleID,omitnil,omitempty" name:"RuleID"`

	// The update time, which is only used as an output parameter.
	UpdateTime *string `json:"UpdateTime,omitnil,omitempty" name:"UpdateTime"`

	// IP ban duration. Range: 0-2 days. It's required when `Action=ban`.
	PunishTime *int64 `json:"PunishTime,omitnil,omitempty" name:"PunishTime"`

	// The unit of the IP ban duration. Values:
	// <li>`second`: Second</li>
	// <li>`minutes`: Minute</li>
	// <li>`hour`: Hour</li>Default value: `second`.
	PunishTimeUnit *string `json:"PunishTimeUnit,omitnil,omitempty" name:"PunishTimeUnit"`

	// Name of the custom return page. It's required when `Action=page`.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// (Disused) ID of the custom return page. The default value is 0, which means that the system default blocking page is used.
	PageId *int64 `json:"PageId,omitnil,omitempty" name:"PageId"`

	// ID of custom response. The ID can be obtained via the `DescribeCustomErrorPages` API. It's required when `Action=page`.
	CustomResponseId *string `json:"CustomResponseId,omitnil,omitempty" name:"CustomResponseId"`

	// The response code to trigger the return page. It's required when `Action=page`. Value: 100-600. 3xx response codes are not supported. Default value: 567.
	ResponseCode *int64 `json:"ResponseCode,omitnil,omitempty" name:"ResponseCode"`

	// The redirection URL. It's required when `Action=redirect`.
	RedirectUrl *string `json:"RedirectUrl,omitnil,omitempty" name:"RedirectUrl"`
}

type Action 

type Action struct {
	// Common feature operations. The options for this category include:
	// <li> Access URL overriding (AccessUrlRedirect);</li>
	// <li> Origin URL overriding (UpstreamUrlRedirect);</li>
	// <li> QUIC;</li>
	// <li> WebSocket;</li>
	// <li> Video dragging (VideoSeek);</li>
	// <li> Token authentication (Authentication);</li>
	// <li> Custom CacheKey (CacheKey);</li>
	// <li> Node caching TTL (Cache);</li>
	// <li> Browser caching TTL (MaxAge);</li>
	// <li> Offline caching (OfflineCache);</li>
	// <li> Smart routing (SmartRouting);</li>
	// <li> Range-based origin pull (RangeOriginPull);</li>
	// <li> HTTP/2 origin pull (UpstreamHttp2);</li>
	// <li> Host header overriding (HostHeader);</li>
	// <li> Forced HTTPS (ForceRedirect);</li>
	// <li> HTTPS origin pull (OriginPullProtocol);</li>
	// <li> Cache pre-refresh (CachePrefresh);</li>
	// <li> Smart compression (Compression);</li>
	// <li> Hsts;</li>
	// <li> ClientIpHeader;</li>
	// <li> SslTlsSecureConf;</li>
	// <li> OcspStapling;</li>
	// <li> HTTP/2 access (Http2);</li>
	// <li> Redirection during origin pull (UpstreamFollowRedirect);</li>
	// <li> Modifying origin server (Origin);</li>
	// <li> Layer 7 origin pull timeout (HTTPUpstreamTimeout);</li>
	// <li> HTTP response (HttpResponse).</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	NormalAction *NormalAction `json:"NormalAction,omitnil,omitempty" name:"NormalAction"`

	// Feature operation with a request/response header. Features of this type include:
	// <li>`RequestHeader`: HTTP request header modification.</li>
	// <li>`ResponseHeader`: HTTP response header modification.</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	RewriteAction *RewriteAction `json:"RewriteAction,omitnil,omitempty" name:"RewriteAction"`

	// Feature operation with a status code. Features of this type include:
	// <li>`ErrorPage`: Custom error page.</li>
	// <li>`StatusCodeCache`: Status code cache TTL.</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	CodeAction *CodeAction `json:"CodeAction,omitnil,omitempty" name:"CodeAction"`
}

type AdvancedFilter 

type AdvancedFilter struct {
	// Field to be filtered.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// Value of the filtered field.
	Values []*string `json:"Values,omitnil,omitempty" name:"Values"`

	// Whether to enable fuzzy query.
	Fuzzy *bool `json:"Fuzzy,omitnil,omitempty" name:"Fuzzy"`
}

type AiRule 

type AiRule struct {
	// The status of the AI rule engine. Values:
	// <li>`smart_status_close`: Disabled</li>
	// <li>`smart_status_open`: Block</li>
	// <li>`smart_status_observe`: Observe</li>
	Mode *string `json:"Mode,omitnil,omitempty" name:"Mode"`
}

type AlgDetectJS 

type AlgDetectJS struct {
	// Method to validate client behavior.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// Proof-of-work strength. Values:
	// <li>`low` (default): Low</li>
	// <li>`middle`: Medium</li>
	// <li>`high`: High</li>
	WorkLevel *string `json:"WorkLevel,omitnil,omitempty" name:"WorkLevel"`

	// Implement a delay before executing JS in milliseconds. Value range: 0-1000. Default value: 500.
	ExecuteMode *int64 `json:"ExecuteMode,omitnil,omitempty" name:"ExecuteMode"`

	// The period threshold for validating the result "Client JS disabled" in seconds. Value range: 5-3600. Default value: 10.
	InvalidStatTime *int64 `json:"InvalidStatTime,omitnil,omitempty" name:"InvalidStatTime"`

	// The number of times for the result "Client JS disabled" occurred in the specified period. Value range: 1-100000000. Default value: 30.
	InvalidThreshold *int64 `json:"InvalidThreshold,omitnil,omitempty" name:"InvalidThreshold"`

	// Client behavior validation results.
	AlgDetectResults []*AlgDetectResult `json:"AlgDetectResults,omitnil,omitempty" name:"AlgDetectResults"`
}

type AlgDetectResult 

type AlgDetectResult struct {
	// The validation result. Values:
	// <li>`invalid`: Invalid Cookie</li>
	// <li>`cookie_empty`: No Cookie/Cookie expired</li>
	// <li>`js_empty`: Client JS disabled</li>
	// <li>`low`: Low-risk session</li>
	// <li>`middle`: Medium-risk session</li>
	// <li>`high`: High-risk session</li>
	// <li>`timeout`: JS validation timed out</li>
	// <li>`not_browser`: Invalid browser</li>
	// <li>`is_bot`: Bot client</li>
	Result *string `json:"Result,omitnil,omitempty" name:"Result"`

	// The action. Values:
	// <li>`drop`: Block</li>
	// <li>`monitor`: Observe</li>
	// <li>`silence`: Drop w/o response</li>
	// <li>`shortdelay`: Add short latency</li>
	// <li>`longdelay`: Add long latency</li>
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`
}

type AlgDetectRule 

type AlgDetectRule struct {
	// ID of the rule.
	RuleID *int64 `json:"RuleID,omitnil,omitempty" name:"RuleID"`

	// Name of the rule.
	RuleName *string `json:"RuleName,omitnil,omitempty" name:"RuleName"`

	// Whether to enable the rule.
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// Condition specified for the rule.
	AlgConditions []*AclCondition `json:"AlgConditions,omitnil,omitempty" name:"AlgConditions"`

	// Validate Cookie when the condition is satisfied.
	// Note: This field may return `null`, indicating that no valid values can be obtained.
	AlgDetectSession *AlgDetectSession `json:"AlgDetectSession,omitnil,omitempty" name:"AlgDetectSession"`

	// Validate client behavior when the condition is satisfied.
	AlgDetectJS []*AlgDetectJS `json:"AlgDetectJS,omitnil,omitempty" name:"AlgDetectJS"`

	// The update time, which is only used as an output parameter.
	UpdateTime *string `json:"UpdateTime,omitnil,omitempty" name:"UpdateTime"`
}

type AlgDetectSession 

type AlgDetectSession struct {
	// Method to validate Cookie.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// The validation mode. Values:
	// <li>`detect`: Validate only</li>
	// <li>`update_detect` (default): Update Cookie and validate</li>
	DetectMode *string `json:"DetectMode,omitnil,omitempty" name:"DetectMode"`

	// Whether to enable Cookie-based session check. The default value is `off`. Values:
	// <li>`off`: Disable</li>
	// <li>`on`: Enable</li>
	SessionAnalyzeSwitch *string `json:"SessionAnalyzeSwitch,omitnil,omitempty" name:"SessionAnalyzeSwitch"`

	// The period threshold for validating the result "No Cookie/Cookie expired" in seconds. Value range: 5-3600. Default value: 10.
	InvalidStatTime *int64 `json:"InvalidStatTime,omitnil,omitempty" name:"InvalidStatTime"`

	// The number of times for the result "No Cookie/Cookie expired" occurred in the specified period. Value range: 1-100000000. Default value: 300.
	InvalidThreshold *int64 `json:"InvalidThreshold,omitnil,omitempty" name:"InvalidThreshold"`

	// Cookie validation results.
	AlgDetectResults []*AlgDetectResult `json:"AlgDetectResults,omitnil,omitempty" name:"AlgDetectResults"`

	// Cookie-based session check results.
	SessionBehaviors []*AlgDetectResult `json:"SessionBehaviors,omitnil,omitempty" name:"SessionBehaviors"`
}

type AliasDomain 

type AliasDomain struct {
	// The alias domain name.
	AliasName *string `json:"AliasName,omitnil,omitempty" name:"AliasName"`

	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The target domain name.
	TargetName *string `json:"TargetName,omitnil,omitempty" name:"TargetName"`

	// Status of the alias domain name. Values:
	// <li>`active`: Activated</li>
	// <li>`pending`: Deploying</li>
	// <li>`conflict`: Reclaimed</li>
	// <li>`stop`: Stopped</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// The blocking mode. Values:
	// <li>`0`: Not blocked</li>
	// <li>`11`: Blocked due to regulatory compliance</li>
	// <li>`14`: Blocked due to ICP filing not obtained</li>
	ForbidMode *int64 `json:"ForbidMode,omitnil,omitempty" name:"ForbidMode"`

	// Creation time of the alias domain name.
	CreatedOn *string `json:"CreatedOn,omitnil,omitempty" name:"CreatedOn"`

	// Modification time of the alias domain name.
	ModifiedOn *string `json:"ModifiedOn,omitnil,omitempty" name:"ModifiedOn"`
}

type ApplicationProxy 

type ApplicationProxy struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The site name.
	ZoneName *string `json:"ZoneName,omitnil,omitempty" name:"ZoneName"`

	// The proxy ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// The domain name or subdomain name when `ProxyType=hostname`.
	// The instance name when `ProxyType=instance`.
	ProxyName *string `json:"ProxyName,omitnil,omitempty" name:"ProxyName"`

	// The proxy type. Values:
	// <li>`hostname`: The proxy is created by subdomain name.</li>
	// <li>`instance`: The proxy is created by instance.</li>
	ProxyType *string `json:"ProxyType,omitnil,omitempty" name:"ProxyType"`

	// The scheduling mode. Values:
	// <li>`ip`: Schedule via Anycast IP.</li>
	// <li>`domain`: Schedule via CNAME.</li>
	PlatType *string `json:"PlatType,omitnil,omitempty" name:"PlatType"`

	// Acceleration region. Values:
	// <li>`mainland`: Chinese mainland.</li>
	// <li>`overseas`: Global (outside the Chinese mainland);</li>
	// Default value: overseas.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// Whether to enable security protection. Values:
	// <li>`0`: Disable security protection.</li>
	// <li>`1`: Enable security protection.</li>
	SecurityType *int64 `json:"SecurityType,omitnil,omitempty" name:"SecurityType"`

	// Whether to enable acceleration. Values:
	// <li>`0`: Disable acceleration.</li>
	// <li>`1`: Enable acceleration.</li>
	AccelerateType *int64 `json:"AccelerateType,omitnil,omitempty" name:"AccelerateType"`

	// The session persistence duration.
	SessionPersistTime *uint64 `json:"SessionPersistTime,omitnil,omitempty" name:"SessionPersistTime"`

	// The rule status. Values:
	// <li>`online`: Enabled</li>
	// <li>`offline`: Disabled</li>
	// <li>`progress`: Deploying</li>
	// <li>`stopping`: Disabling</li>
	// <li>`fail`: Failed to deploy or disable</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// The blocking status of the proxy. Values:
	// <li>`banned`: Blocked</li>
	// <li>`banning`: Blocking</li>
	// <li>`recover`: Unblocked</li>
	// <li>`recovering`: Unblocking</li>
	BanStatus *string `json:"BanStatus,omitnil,omitempty" name:"BanStatus"`

	// Scheduling information.
	ScheduleValue []*string `json:"ScheduleValue,omitnil,omitempty" name:"ScheduleValue"`

	// When `ProxyType=hostname`:
	// This field indicates the unique ID of the subdomain name.
	HostId *string `json:"HostId,omitnil,omitempty" name:"HostId"`

	// The IPv6 access configuration.
	Ipv6 *Ipv6 `json:"Ipv6,omitnil,omitempty" name:"Ipv6"`

	// The update time.
	UpdateTime *string `json:"UpdateTime,omitnil,omitempty" name:"UpdateTime"`

	// List of rules.
	ApplicationProxyRules []*ApplicationProxyRule `json:"ApplicationProxyRules,omitnil,omitempty" name:"ApplicationProxyRules"`

	// Cross-MLC-border acceleration.
	AccelerateMainland *AccelerateMainland `json:"AccelerateMainland,omitnil,omitempty" name:"AccelerateMainland"`
}

type ApplicationProxyRule 

type ApplicationProxyRule struct {
	// Protocol. Valid values:
	// <li>TCP: TCP protocol;</li>
	// <li>UDP: UDP protocol.</li>
	Proto *string `json:"Proto,omitnil,omitempty" name:"Proto"`

	// Port. Supported formats:
	// <li>A single port, such as 80.</li>
	// <li>A port range, such as 81-82, indicating two ports 81 and 82.</li>
	// Note: Up to 20 ports can be input for each rule.
	Port []*string `json:"Port,omitnil,omitempty" name:"Port"`

	// Origin server type. Valid values:
	// <li>custom: manually added;</li>
	// <li>loadbalancer: cloud load balancer;</li>
	// <li>origins: origin server group.</li>
	OriginType *string `json:"OriginType,omitnil,omitempty" name:"OriginType"`

	// Origin server information.
	// <li>When OriginType is custom, it indicates one or more origin servers, such as `["8.8.8.8","9.9.9.9"]` or `OriginValue=["test.com"]`;</li>
	// <li>When OriginType is loadbalancer, it indicates a cloud load balancer, such as ["lb-xdffsfasdfs"];</li>
	// <li>When OriginType is origins, it requires one and only one element, indicating the origin server group ID, such as ["origin-537f5b41-162a-11ed-abaa-525400c5da15"].</li>
	OriginValue []*string `json:"OriginValue,omitnil,omitempty" name:"OriginValue"`

	// Rule ID.
	RuleId *string `json:"RuleId,omitnil,omitempty" name:"RuleId"`

	// Status. Valid values:
	// <li>online: enabled;</li>
	// <li>offline: disabled;</li>
	// <li>progress: deploying;</li>
	// <li>stopping: disabling;</li>
	// <li>fail: deployment or disabling failed.</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// Passing the client IP address. Valid values:
	// <li>TOA: passing via TOA, available only when Proto = TCP;</li>
	// <li>PPV1: passing via Proxy Protocol V1, available only when Proto = TCP;</li>
	// <li>PPV2: passing via Proxy Protocol V2;</li>
	// <li>OFF: no passing.</li>Default value: OFF.
	ForwardClientIp *string `json:"ForwardClientIp,omitnil,omitempty" name:"ForwardClientIp"`

	// Whether to enable session persistence. Valid values:
	// <li>true: Enable;</li>
	// <li>false: Disable.</li>Default value: false.
	SessionPersist *bool `json:"SessionPersist,omitnil,omitempty" name:"SessionPersist"`

	// Duration for session persistence. The value takes effect only when SessionPersist is true.
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	SessionPersistTime *uint64 `json:"SessionPersistTime,omitnil,omitempty" name:"SessionPersistTime"`

	// Origin server port. Supported formats:
	// <li>A single port, such as 80.</li>
	// <li>A port range, such as 81-82, indicating two ports 81 and 82.</li>
	OriginPort *string `json:"OriginPort,omitnil,omitempty" name:"OriginPort"`

	// Rule tag.
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	RuleTag *string `json:"RuleTag,omitnil,omitempty" name:"RuleTag"`
}

type AscriptionInfo 

type AscriptionInfo struct {
	Subdomain *string `json:"Subdomain,omitnil,omitempty" name:"Subdomain"`

	// The record type.
	RecordType *string `json:"RecordType,omitnil,omitempty" name:"RecordType"`

	// The record value.
	RecordValue *string `json:"RecordValue,omitnil,omitempty" name:"RecordValue"`
}

type BillingData 

type BillingData struct {
	// Time.
	Time *string `json:"Time,omitnil,omitempty" name:"Time"`

	// Value.
	Value *uint64 `json:"Value,omitnil,omitempty" name:"Value"`
}

type BillingDataFilter 

type BillingDataFilter struct {
	// Parameter name.
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// Parameter value.
	Value *string `json:"Value,omitnil,omitempty" name:"Value"`
}

type BindSecurityTemplateToEntityRequest 

type BindSecurityTemplateToEntityRequest struct {
	*tchttp.BaseRequest

	// Site ID of the policy template to be bound to or unbound from.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// List of domain names to bind to/unbind from a policy template
	Entities []*string `json:"Entities,omitnil,omitempty" name:"Entities"`

	// Action options. Values include:
	// <li>`bind`: Bind the domain names to the specified policy template </li>
	// <li>`unbind-keep-policy`: Unbind a domain name from a policy template and keep the current policy when unbinding</li>
	// <li>`unbind-use-default`: Unbind domain names from policy templates and use default blank policy.</li> Note: Only one domain name can be unbound at one time. When `Operate` is `unbind-keep-policy` or `unbind-use-default`, there can only be one domain name specified in `Entities`.
	Operate *string `json:"Operate,omitnil,omitempty" name:"Operate"`

	// Specifies the ID of the policy template or the site's global policy to be bound or unbound.
	// - To bind to a policy template, or unbind from it, specify the policy template ID.
	// - To bind to the site's global policy, or unbind from it, use the @ZoneLevel@domain parameter value.
	//
	// Note: After unbinding, the domain name will use an independent policy and rule quota will be calculated separately. Please make sure there is sufficient rule quota before unbinding.
	TemplateId *string `json:"TemplateId,omitnil,omitempty" name:"TemplateId"`

	// Whether to replace the existing policy template bound with the domain name. Values:
	// <li>`true`: Replace the template bound to the domain. </li>
	// <li>`false`: Do not replace the template.</li> Note: In this case, the API returns an error if there is already a policy template bound to the specified domain name.
	OverWrite *bool `json:"OverWrite,omitnil,omitempty" name:"OverWrite"`
}

func NewBindSecurityTemplateToEntityRequest 

func NewBindSecurityTemplateToEntityRequest() (request *BindSecurityTemplateToEntityRequest)

func (*BindSecurityTemplateToEntityRequest) FromJsonString 

func (r *BindSecurityTemplateToEntityRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*BindSecurityTemplateToEntityRequest) ToJsonString 

func (r *BindSecurityTemplateToEntityRequest) ToJsonString() string

type BindSecurityTemplateToEntityRequestParams 

type BindSecurityTemplateToEntityRequestParams struct {
	// Site ID of the policy template to be bound to or unbound from.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// List of domain names to bind to/unbind from a policy template
	Entities []*string `json:"Entities,omitnil,omitempty" name:"Entities"`

	// Action options. Values include:
	// <li>`bind`: Bind the domain names to the specified policy template </li>
	// <li>`unbind-keep-policy`: Unbind a domain name from a policy template and keep the current policy when unbinding</li>
	// <li>`unbind-use-default`: Unbind domain names from policy templates and use default blank policy.</li> Note: Only one domain name can be unbound at one time. When `Operate` is `unbind-keep-policy` or `unbind-use-default`, there can only be one domain name specified in `Entities`.
	Operate *string `json:"Operate,omitnil,omitempty" name:"Operate"`

	// Specifies the ID of the policy template or the site's global policy to be bound or unbound.
	// - To bind to a policy template, or unbind from it, specify the policy template ID.
	// - To bind to the site's global policy, or unbind from it, use the @ZoneLevel@domain parameter value.
	//
	// Note: After unbinding, the domain name will use an independent policy and rule quota will be calculated separately. Please make sure there is sufficient rule quota before unbinding.
	TemplateId *string `json:"TemplateId,omitnil,omitempty" name:"TemplateId"`

	// Whether to replace the existing policy template bound with the domain name. Values:
	// <li>`true`: Replace the template bound to the domain. </li>
	// <li>`false`: Do not replace the template.</li> Note: In this case, the API returns an error if there is already a policy template bound to the specified domain name.
	OverWrite *bool `json:"OverWrite,omitnil,omitempty" name:"OverWrite"`
}

Predefined struct for user

type BindSecurityTemplateToEntityResponse 

type BindSecurityTemplateToEntityResponse struct {
	*tchttp.BaseResponse
	Response *BindSecurityTemplateToEntityResponseParams `json:"Response"`
}

func NewBindSecurityTemplateToEntityResponse 

func NewBindSecurityTemplateToEntityResponse() (response *BindSecurityTemplateToEntityResponse)

func (*BindSecurityTemplateToEntityResponse) FromJsonString 

func (r *BindSecurityTemplateToEntityResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*BindSecurityTemplateToEntityResponse) ToJsonString 

func (r *BindSecurityTemplateToEntityResponse) ToJsonString() string

type BindSecurityTemplateToEntityResponseParams 

type BindSecurityTemplateToEntityResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type BindSharedCNAMEMap 

type BindSharedCNAMEMap struct {
	// The shared CNAME to be bound with or unbound from.
	SharedCNAME *string `json:"SharedCNAME,omitnil,omitempty" name:"SharedCNAME"`

	// Acceleration domains (up to 20).
	DomainNames []*string `json:"DomainNames,omitnil,omitempty" name:"DomainNames"`
}

type BindSharedCNAMERequest 

type BindSharedCNAMERequest struct {
	*tchttp.BaseRequest

	// ID of the site related with the acceleration domain name.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Action type. Values:
	// <li>`bind`: To bind</li>
	// <li>`unbind`: To unbind</li>
	BindType *string `json:"BindType,omitnil,omitempty" name:"BindType"`

	// Bindings between domain names and a shared CNAME
	BindSharedCNAMEMaps []*BindSharedCNAMEMap `json:"BindSharedCNAMEMaps,omitnil,omitempty" name:"BindSharedCNAMEMaps"`
}

func NewBindSharedCNAMERequest 

func NewBindSharedCNAMERequest() (request *BindSharedCNAMERequest)

func (*BindSharedCNAMERequest) FromJsonString 

func (r *BindSharedCNAMERequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*BindSharedCNAMERequest) ToJsonString 

func (r *BindSharedCNAMERequest) ToJsonString() string

type BindSharedCNAMERequestParams 

type BindSharedCNAMERequestParams struct {
	// ID of the site related with the acceleration domain name.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Action type. Values:
	// <li>`bind`: To bind</li>
	// <li>`unbind`: To unbind</li>
	BindType *string `json:"BindType,omitnil,omitempty" name:"BindType"`

	// Bindings between domain names and a shared CNAME
	BindSharedCNAMEMaps []*BindSharedCNAMEMap `json:"BindSharedCNAMEMaps,omitnil,omitempty" name:"BindSharedCNAMEMaps"`
}

Predefined struct for user

type BindSharedCNAMEResponse 

type BindSharedCNAMEResponse struct {
	*tchttp.BaseResponse
	Response *BindSharedCNAMEResponseParams `json:"Response"`
}

func NewBindSharedCNAMEResponse 

func NewBindSharedCNAMEResponse() (response *BindSharedCNAMEResponse)

func (*BindSharedCNAMEResponse) FromJsonString 

func (r *BindSharedCNAMEResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*BindSharedCNAMEResponse) ToJsonString 

func (r *BindSharedCNAMEResponse) ToJsonString() string

type BindSharedCNAMEResponseParams 

type BindSharedCNAMEResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type BindZoneToPlanRequest 

type BindZoneToPlanRequest struct {
	*tchttp.BaseRequest

	// ID of the site to be bound.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// ID of the target plan.
	PlanId *string `json:"PlanId,omitnil,omitempty" name:"PlanId"`
}

func NewBindZoneToPlanRequest 

func NewBindZoneToPlanRequest() (request *BindZoneToPlanRequest)

func (*BindZoneToPlanRequest) FromJsonString 

func (r *BindZoneToPlanRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*BindZoneToPlanRequest) ToJsonString 

func (r *BindZoneToPlanRequest) ToJsonString() string

type BindZoneToPlanRequestParams 

type BindZoneToPlanRequestParams struct {
	// ID of the site to be bound.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// ID of the target plan.
	PlanId *string `json:"PlanId,omitnil,omitempty" name:"PlanId"`
}

Predefined struct for user

type BindZoneToPlanResponse 

type BindZoneToPlanResponse struct {
	*tchttp.BaseResponse
	Response *BindZoneToPlanResponseParams `json:"Response"`
}

func NewBindZoneToPlanResponse 

func NewBindZoneToPlanResponse() (response *BindZoneToPlanResponse)

func (*BindZoneToPlanResponse) FromJsonString 

func (r *BindZoneToPlanResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*BindZoneToPlanResponse) ToJsonString 

func (r *BindZoneToPlanResponse) ToJsonString() string

type BindZoneToPlanResponseParams 

type BindZoneToPlanResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type BotConfig 

type BotConfig struct {
	// Whether to enable bot security. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// The settings of the bot managed rule. If it is null, the settings that were last configured will be used.
	BotManagedRule *BotManagedRule `json:"BotManagedRule,omitnil,omitempty" name:"BotManagedRule"`

	// The settings of the client reputation rule. If it is null, the settings that were last configured will be used.
	BotPortraitRule *BotPortraitRule `json:"BotPortraitRule,omitnil,omitempty" name:"BotPortraitRule"`

	// The bot intelligence settings. If it is null, the settings that were last configured will be used.
	// Note: This field may return null, indicating that no valid values can be obtained.
	IntelligenceRule *IntelligenceRule `json:"IntelligenceRule,omitnil,omitempty" name:"IntelligenceRule"`

	// Settings of the custom bot rule. If it is null, the settings that were last configured will be used.
	BotUserRules []*BotUserRule `json:"BotUserRules,omitnil,omitempty" name:"BotUserRules"`

	// Active bot detection rule.
	AlgDetectRule []*AlgDetectRule `json:"AlgDetectRule,omitnil,omitempty" name:"AlgDetectRule"`

	// Settings of the bot managed rule. It is only used for output.
	// Note: This field may return `null`, indicating that no valid values can be obtained.
	Customizes []*BotUserRule `json:"Customizes,omitnil,omitempty" name:"Customizes"`
}

type BotExtendAction 

type BotExtendAction struct {
	// Action. Valid values:
	// <li>`monitor`: Observe;</li>
	// <li>`alg`: JavaScript challenge;</li>
	// <li>`captcha`: Managed challenge;</li>
	// <li>`random`: Actions are executed based on the percentage specified in `ExtendActions`;</li>
	// <li>`silence`: Silence;</li>
	// <li>`shortdelay`: Add short latency;</li>
	// <li>`longdelay`: Add long latency.</li>
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`

	// The probability for triggering the action. Value range: 0-100.
	// Note: This field may return `null`, indicating that no valid values can be obtained.
	Percent *uint64 `json:"Percent,omitnil,omitempty" name:"Percent"`
}

type BotManagedRule 

type BotManagedRule struct {
	// The rule action. Values:
	// <li>`drop`: Block</li>
	// <li>`trans`: Allow</li>
	// <li>`alg`: JavaScript challenge</li>
	// <li>`monitor`: Observe</li>
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`

	// The rule ID, which is only used as an output parameter.
	RuleID *int64 `json:"RuleID,omitnil,omitempty" name:"RuleID"`

	// The ID of the rule that applies the "Allow" action.
	// Note: This field may return null, indicating that no valid values can be obtained.
	TransManagedIds []*int64 `json:"TransManagedIds,omitnil,omitempty" name:"TransManagedIds"`

	// The ID of the rule that applies the "JavaScript challenge" action.
	// Note: This field may return null, indicating that no valid values can be obtained.
	AlgManagedIds []*int64 `json:"AlgManagedIds,omitnil,omitempty" name:"AlgManagedIds"`

	// The ID of the rule that applies the "Managed challenge" action.
	// Note: This field may return null, indicating that no valid values can be obtained.
	CapManagedIds []*int64 `json:"CapManagedIds,omitnil,omitempty" name:"CapManagedIds"`

	// The ID of the rule that applies the "Observe" action.
	// Note: This field may return null, indicating that no valid values can be obtained.
	MonManagedIds []*int64 `json:"MonManagedIds,omitnil,omitempty" name:"MonManagedIds"`

	// The ID of the rule that applies the "Block" action.
	// Note: This field may return null, indicating that no valid values can be obtained.
	DropManagedIds []*int64 `json:"DropManagedIds,omitnil,omitempty" name:"DropManagedIds"`
}

type BotPortraitRule 

type BotPortraitRule struct {
	// Switch. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// The rule ID, which is only used as an output parameter.
	RuleID *int64 `json:"RuleID,omitnil,omitempty" name:"RuleID"`

	// The ID of the rule that applies the "JavaScript challenge" action.
	// Note: This field may return null, indicating that no valid values can be obtained.
	AlgManagedIds []*int64 `json:"AlgManagedIds,omitnil,omitempty" name:"AlgManagedIds"`

	// The ID of the rule that applies the "Managed challenge" action.
	// Note: This field may return null, indicating that no valid values can be obtained.
	CapManagedIds []*int64 `json:"CapManagedIds,omitnil,omitempty" name:"CapManagedIds"`

	// The ID of the rule that applies the "Observe" action.
	// Note: This field may return null, indicating that no valid values can be obtained.
	MonManagedIds []*int64 `json:"MonManagedIds,omitnil,omitempty" name:"MonManagedIds"`

	// The ID of the rule that applies the "Block" action.
	// Note: This field may return null, indicating that no valid values can be obtained.
	DropManagedIds []*int64 `json:"DropManagedIds,omitnil,omitempty" name:"DropManagedIds"`
}

type BotUserRule 

type BotUserRule struct {
	RuleName *string `json:"RuleName,omitnil,omitempty" name:"RuleName"`

	// The action. Values:
	// <li>`drop`: Block the request</li>
	// <li>`monitor`: Observe</li>
	// <li>`trans`: Allow</li>
	// <li>`redirect`: Redirect the request</li>
	// <li>`page`: Return the specified page</li>
	// <li>`alg`: JavaScript challenge</li>
	// <li>`captcha`: Managed challenge</li>
	// <li>`random`: Handle the request randomly by the weight</li>
	// <li>`silence`: Keep the connection but do not response to the client</li>
	// <li>`shortdelay`: Add a short latency period</li>
	// <li>`longdelay`: Add a long latency period</li>
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`

	// The rule status. Values:
	// <li>`on`: Enabled</li>
	// <li>`off`: Disabled</li>Default value: `on`
	RuleStatus *string `json:"RuleStatus,omitnil,omitempty" name:"RuleStatus"`

	// Details of the rule.
	AclConditions []*AclCondition `json:"AclConditions,omitnil,omitempty" name:"AclConditions"`

	// The rule weight. Value range: 0-100.
	RulePriority *int64 `json:"RulePriority,omitnil,omitempty" name:"RulePriority"`

	// Rule ID, which is only used as an output parameter.
	RuleID *int64 `json:"RuleID,omitnil,omitempty" name:"RuleID"`

	// [Currently unavailable] Specify the random action and percentage.
	ExtendActions []*BotExtendAction `json:"ExtendActions,omitnil,omitempty" name:"ExtendActions"`

	// The filter. Values:
	// <li>`sip`: Client IP</li>
	// This parameter is left empty by default.
	FreqFields []*string `json:"FreqFields,omitnil,omitempty" name:"FreqFields"`

	// The update time, which is only used as an output parameter.
	UpdateTime *string `json:"UpdateTime,omitnil,omitempty" name:"UpdateTime"`

	// Query scope. Values:
	// <li>`source_to_eo`: (Response) Traffic going from the origin to EdgeOne.</li>
	// <li>`client_to_eo`: (Request) Traffic going from the client to EdgeOne.</li>
	// Default: `source_to_eo`.
	FreqScope []*string `json:"FreqScope,omitnil,omitempty" name:"FreqScope"`

	// Name of the custom return page. It's required when `Action=page`.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// ID of custom response. The ID can be obtained via the `DescribeCustomErrorPages` API. It's required when `Action=page`.
	CustomResponseId *string `json:"CustomResponseId,omitnil,omitempty" name:"CustomResponseId"`

	// The response code to trigger the return page. It's required when `Action=page`. Value: 100-600. 3xx response codes are not supported. Default value: 567.
	ResponseCode *int64 `json:"ResponseCode,omitnil,omitempty" name:"ResponseCode"`

	// The redirection URL. It's required when `Action=redirect`.
	RedirectUrl *string `json:"RedirectUrl,omitnil,omitempty" name:"RedirectUrl"`
}

type CC 

type CC struct {
	// WAF switch. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// ID of the policy
	PolicyId *int64 `json:"PolicyId,omitnil,omitempty" name:"PolicyId"`
}

type CLSTopic 

type CLSTopic struct {
	// The ID of the Tencent Cloud CLS log set.
	LogSetId *string `json:"LogSetId,omitnil,omitempty" name:"LogSetId"`

	// The ID of the Tencent Cloud CLS log topic.
	TopicId *string `json:"TopicId,omitnil,omitempty" name:"TopicId"`

	// The region of the Tencent Cloud CLS log set.
	LogSetRegion *string `json:"LogSetRegion,omitnil,omitempty" name:"LogSetRegion"`
}

type Cache 

type Cache struct {
	// Whether to enable cache configuration. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// Cache expiration time setting.
	// Unit: second. The maximum value is 365 days.
	// Note: This field may return null, indicating that no valid values can be obtained.
	CacheTime *int64 `json:"CacheTime,omitnil,omitempty" name:"CacheTime"`

	// Whether to enable force cache. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable </li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	//
	// Deprecated: IgnoreCacheControl is deprecated.
	IgnoreCacheControl *string `json:"IgnoreCacheControl,omitnil,omitempty" name:"IgnoreCacheControl"`
}

type CacheConfig 

type CacheConfig struct {
	// Cache configuration
	// Note: This field may return null, indicating that no valid values can be obtained.
	Cache *Cache `json:"Cache,omitnil,omitempty" name:"Cache"`

	// No-cache configuration
	// Note: This field may return null, indicating that no valid values can be obtained.
	NoCache *NoCache `json:"NoCache,omitnil,omitempty" name:"NoCache"`

	// Follows the origin server configuration
	// Note: This field may return null, indicating that no valid values can be obtained.
	FollowOrigin *FollowOrigin `json:"FollowOrigin,omitnil,omitempty" name:"FollowOrigin"`
}

type CacheKey 

type CacheKey struct {
	// Whether to enable full-path cache. Values:
	// <li>`on`: Enable full-path cache (i.e., disable Ignore Query String).</li>
	// <li>`off`: Disable full-path cache (i.e., enable Ignore Query String).</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	FullUrlCache *string `json:"FullUrlCache,omitnil,omitempty" name:"FullUrlCache"`

	// Whether to ignore case in the cache key. Values:
	// <li>`on`: Ignore</li>
	// <li>`off`: Not ignore</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	IgnoreCase *string `json:"IgnoreCase,omitnil,omitempty" name:"IgnoreCase"`

	// Request parameter contained in `CacheKey`.
	// Note: This field may return `null`, indicating that no valid values can be obtained.
	QueryString *QueryString `json:"QueryString,omitnil,omitempty" name:"QueryString"`
}

type CachePrefresh 

type CachePrefresh struct {
	// Whether to enable cache prefresh. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// The cache prefresh percentage. Values: 1-99
	// Note: This field may return null, indicating that no valid values can be obtained.
	Percent *int64 `json:"Percent,omitnil,omitempty" name:"Percent"`
}

type CacheTag 

type CacheTag struct {
	// List of domain names to purge cache for.
	Domains []*string `json:"Domains,omitnil,omitempty" name:"Domains"`
}

type CertificateInfo 

type CertificateInfo struct {
	// Certificate ID, which originates from the SSL side. You can check the CertId from the [SSL Certificate List](https://console.cloud.tencent.com/ssl).
	CertId *string `json:"CertId,omitnil,omitempty" name:"CertId"`

	// Alias of the certificate.
	Alias *string `json:"Alias,omitnil,omitempty" name:"Alias"`

	// Type of the certificate. Values:
	// <li>`default`: Default certificate</li>
	// <li>`upload`: Specified certificate</li>
	// <li>`managed`: Tencent Cloud-managed certificate</li>
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// The certificate expiration time.
	ExpireTime *string `json:"ExpireTime,omitnil,omitempty" name:"ExpireTime"`

	// Time when the certificate is deployed.
	DeployTime *string `json:"DeployTime,omitnil,omitempty" name:"DeployTime"`

	// Signature algorithm.
	SignAlgo *string `json:"SignAlgo,omitnil,omitempty" name:"SignAlgo"`

	// Status of the certificate. Values:
	// u200c<li>`deployed`: The deployment has completed</li>
	// u200c<li>`processing`: Deployment in progress</li>
	// u200c<li>`applying`: Application in progress</li>
	// u200c<li>`failed`: Application rejected</li>
	// <li>`issued`: Binding failed.</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`
}

type CheckCnameStatusRequest 

type CheckCnameStatusRequest struct {
	*tchttp.BaseRequest

	// Site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// List of accelerated domain names.
	RecordNames []*string `json:"RecordNames,omitnil,omitempty" name:"RecordNames"`
}

func NewCheckCnameStatusRequest 

func NewCheckCnameStatusRequest() (request *CheckCnameStatusRequest)

func (*CheckCnameStatusRequest) FromJsonString 

func (r *CheckCnameStatusRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CheckCnameStatusRequest) ToJsonString 

func (r *CheckCnameStatusRequest) ToJsonString() string

type CheckCnameStatusRequestParams 

type CheckCnameStatusRequestParams struct {
	// Site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// List of accelerated domain names.
	RecordNames []*string `json:"RecordNames,omitnil,omitempty" name:"RecordNames"`
}

Predefined struct for user

type CheckCnameStatusResponse 

type CheckCnameStatusResponse struct {
	*tchttp.BaseResponse
	Response *CheckCnameStatusResponseParams `json:"Response"`
}

func NewCheckCnameStatusResponse 

func NewCheckCnameStatusResponse() (response *CheckCnameStatusResponse)

func (*CheckCnameStatusResponse) FromJsonString 

func (r *CheckCnameStatusResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CheckCnameStatusResponse) ToJsonString 

func (r *CheckCnameStatusResponse) ToJsonString() string

type CheckCnameStatusResponseParams 

type CheckCnameStatusResponseParams struct {
	// CNAME status of accelerated domain names.
	CnameStatus []*CnameStatus `json:"CnameStatus,omitnil,omitempty" name:"CnameStatus"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CheckRegionHealthStatus 

type CheckRegionHealthStatus struct {
	// Health check region, which is a two-letter code according to ISO-3166-1.
	Region *string `json:"Region,omitnil,omitempty" name:"Region"`

	// Health status of origin servers in a single health check region. Valid values:
	// <li>Healthy: healthy.</li>
	// <li>Unhealthy: unhealthy.</li>
	// <li>Undetected: no data detected.</li>Note: If all origin servers in a single health check region are healthy, the status is healthy; otherwise, it is unhealthy.
	Healthy *string `json:"Healthy,omitnil,omitempty" name:"Healthy"`

	// Origin server health status.
	OriginHealthStatus []*OriginHealthStatus `json:"OriginHealthStatus,omitnil,omitempty" name:"OriginHealthStatus"`
}

type Client 

type Client struct {
	common.Client
}

func NewClient 

func NewClient(credential common.CredentialIface, region string, clientProfile *profile.ClientProfile) (client *Client, err error)

func NewClientWithSecretId 

func NewClientWithSecretId(secretId, secretKey, region string) (client *Client, err error)

Deprecated

func (*Client) BindSecurityTemplateToEntity 

func (c *Client) BindSecurityTemplateToEntity(request *BindSecurityTemplateToEntityRequest) (response *BindSecurityTemplateToEntityResponse, err error)

BindSecurityTemplateToEntity This API is used to bind/unbind a domain name to/from a specific policy template.

error code that may be returned: 

INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INVALIDPARAMETER_SECURITY = "InvalidParameter.Security"
OPERATIONDENIED = "OperationDenied"
RESOURCEINUSE = "ResourceInUse"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNSUPPORTEDOPERATION = "UnsupportedOperation"

func (*Client) BindSecurityTemplateToEntityWithContext 

func (c *Client) BindSecurityTemplateToEntityWithContext(ctx context.Context, request *BindSecurityTemplateToEntityRequest) (response *BindSecurityTemplateToEntityResponse, err error)

BindSecurityTemplateToEntity This API is used to bind/unbind a domain name to/from a specific policy template.

error code that may be returned: 

INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INVALIDPARAMETER_SECURITY = "InvalidParameter.Security"
OPERATIONDENIED = "OperationDenied"
RESOURCEINUSE = "ResourceInUse"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNSUPPORTEDOPERATION = "UnsupportedOperation"

func (*Client) BindSharedCNAME 

func (c *Client) BindSharedCNAME(request *BindSharedCNAMERequest) (response *BindSharedCNAMEResponse, err error)

BindSharedCNAME This API is used to bind/unbind a domain name to/from a shared CNAME. It is now only available to beta users.

error code that may be returned: 

RESOURCEINUSE = "ResourceInUse"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) BindSharedCNAMEWithContext 

func (c *Client) BindSharedCNAMEWithContext(ctx context.Context, request *BindSharedCNAMERequest) (response *BindSharedCNAMEResponse, err error)

BindSharedCNAME This API is used to bind/unbind a domain name to/from a shared CNAME. It is now only available to beta users.

error code that may be returned: 

RESOURCEINUSE = "ResourceInUse"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) BindZoneToPlan 

func (c *Client) BindZoneToPlan(request *BindZoneToPlanRequest) (response *BindZoneToPlanResponse, err error)

BindZoneToPlan This API is used to bind a site to a plan.

error code that may be returned: 

INTERNALERROR = "InternalError"
INVALIDPARAMETER_PLANNOTFOUND = "InvalidParameter.PlanNotFound"
INVALIDPARAMETER_ZONEHASBEENBOUND = "InvalidParameter.ZoneHasBeenBound"
INVALIDPARAMETER_ZONENOTFOUND = "InvalidParameter.ZoneNotFound"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
LIMITEXCEEDED = "LimitExceeded"
OPERATIONDENIED = "OperationDenied"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) BindZoneToPlanWithContext 

func (c *Client) BindZoneToPlanWithContext(ctx context.Context, request *BindZoneToPlanRequest) (response *BindZoneToPlanResponse, err error)

BindZoneToPlan This API is used to bind a site to a plan.

error code that may be returned: 

INTERNALERROR = "InternalError"
INVALIDPARAMETER_PLANNOTFOUND = "InvalidParameter.PlanNotFound"
INVALIDPARAMETER_ZONEHASBEENBOUND = "InvalidParameter.ZoneHasBeenBound"
INVALIDPARAMETER_ZONENOTFOUND = "InvalidParameter.ZoneNotFound"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
LIMITEXCEEDED = "LimitExceeded"
OPERATIONDENIED = "OperationDenied"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) CheckCnameStatus 

func (c *Client) CheckCnameStatus(request *CheckCnameStatusRequest) (response *CheckCnameStatusResponse, err error)

CheckCnameStatus This API is used to query the CNAME status of a domain name.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) CheckCnameStatusWithContext 

func (c *Client) CheckCnameStatusWithContext(ctx context.Context, request *CheckCnameStatusRequest) (response *CheckCnameStatusResponse, err error)

CheckCnameStatus This API is used to query the CNAME status of a domain name.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) CreateAccelerationDomain 

func (c *Client) CreateAccelerationDomain(request *CreateAccelerationDomainRequest) (response *CreateAccelerationDomainResponse, err error)

CreateAccelerationDomain This API is used to create an acceleration domain name.

For sites connected via the CNAME, if you have not verified the ownership of the domain name, the ownership verification information of the domain name is returned. To verify your ownership of the domain name, see [Ownership Verification](https://intl.cloud.tencent.com/document/product/1552/70789?from_cn_redirect=1).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INVALIDPARAMETER_CONFLICTHOSTORIGIN = "InvalidParameter.ConflictHostOrigin"
INVALIDPARAMETER_ERRINVALIDACTIONPARAM = "InvalidParameter.ErrInvalidActionParam"
INVALIDPARAMETER_INVALIDACCELERATETYPE = "InvalidParameter.InvalidAccelerateType"
INVALIDPARAMETER_INVALIDAWSPRIVATEACCESS = "InvalidParameter.InvalidAwsPrivateAccess"
INVALIDPARAMETER_INVALIDAWSREGION = "InvalidParameter.InvalidAwsRegion"
INVALIDPARAMETER_INVALIDCLIENTIPORIGIN = "InvalidParameter.InvalidClientIpOrigin"
INVALIDPARAMETER_INVALIDIPV6SWITCH = "InvalidParameter.InvalidIpv6Switch"
INVALIDPARAMETER_INVALIDORIGIN = "InvalidParameter.InvalidOrigin"
INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_INVALIDPRIVATEACCESSPARAMS = "InvalidParameter.InvalidPrivateAccessParams"
INVALIDPARAMETER_INVALIDPRIVATEACCESSSWITCH = "InvalidParameter.InvalidPrivateAccessSwitch"
INVALIDPARAMETER_INVALIDQUICBILLING = "InvalidParameter.InvalidQuicBilling"
INVALIDPARAMETER_INVALIDSERVERNAME = "InvalidParameter.InvalidServerName"
INVALIDPARAMETER_INVALIDSTANDARDDEBUGCLIENTIP = "InvalidParameter.InvalidStandardDebugClientIp"
INVALIDPARAMETER_INVALIDWEBSOCKETTIMEOUT = "InvalidParameter.InvalidWebSocketTimeout"
INVALIDPARAMETER_POSTMAXSIZELIMITEXCEEDED = "InvalidParameter.PostMaxSizeLimitExceeded"
INVALIDPARAMETER_SPACENOTBINDORIGIN = "InvalidParameter.SpaceNotBindOrigin"
INVALIDPARAMETER_ZONEISGRAYPUBLISHING = "InvalidParameter.ZoneIsGrayPublishing"
INVALIDPARAMETERVALUE_CONFLICTRECORD = "InvalidParameterValue.ConflictRecord"
INVALIDPARAMETERVALUE_CONFLICTWITHDNSSEC = "InvalidParameterValue.ConflictWithDNSSEC"
INVALIDPARAMETERVALUE_CONFLICTWITHDOMAIN = "InvalidParameterValue.ConflictWithDomain"
INVALIDPARAMETERVALUE_CONFLICTWITHNSRECORD = "InvalidParameterValue.ConflictWithNSRecord"
INVALIDPARAMETERVALUE_CONTENTSAMEASNAME = "InvalidParameterValue.ContentSameAsName"
INVALIDPARAMETERVALUE_DOMAINNOTMATCHZONE = "InvalidParameterValue.DomainNotMatchZone"
INVALIDPARAMETERVALUE_INVALIDDNSCONTENT = "InvalidParameterValue.InvalidDNSContent"
INVALIDPARAMETERVALUE_INVALIDDNSNAME = "InvalidParameterValue.InvalidDNSName"
INVALIDPARAMETERVALUE_INVALIDDOMAINNAME = "InvalidParameterValue.InvalidDomainName"
INVALIDPARAMETERVALUE_INVALIDPROXYORIGIN = "InvalidParameterValue.InvalidProxyOrigin"
INVALIDPARAMETERVALUE_ORIGINGROUPNOTEXISTS = "InvalidParameterValue.OriginGroupNotExists"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ACCELERATEMAINLANDDISABLE = "OperationDenied.AccelerateMainlandDisable"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"
OPERATIONDENIED_DOMAINNOICP = "OperationDenied.DomainNoICP"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_INVALIDADVANCEDDEFENSEZONEAREA = "OperationDenied.InvalidAdvancedDefenseZoneArea"
OPERATIONDENIED_LOADBALANCESTATUSNOTINONLINE = "OperationDenied.LoadBalanceStatusNotInOnline"
OPERATIONDENIED_RECORDISFORBIDDEN = "OperationDenied.RecordIsForbidden"
OPERATIONDENIED_RESOURCELOCKEDTEMPORARY = "OperationDenied.ResourceLockedTemporary"
OPERATIONDENIED_VERSIONCONTROLISGRAYING = "OperationDenied.VersionControlIsGraying"
RESOURCEINUSE = "ResourceInUse"
RESOURCEINUSE_DNSRECORD = "ResourceInUse.DnsRecord"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE_DOMAINALREADYEXISTS = "ResourceUnavailable.DomainAlreadyExists"
RESOURCESSOLDOUT_L7LACKOFRESOURCES = "ResourcesSoldOut.L7LackOfResources"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) CreateAccelerationDomainWithContext 

func (c *Client) CreateAccelerationDomainWithContext(ctx context.Context, request *CreateAccelerationDomainRequest) (response *CreateAccelerationDomainResponse, err error)

CreateAccelerationDomain This API is used to create an acceleration domain name.

For sites connected via the CNAME, if you have not verified the ownership of the domain name, the ownership verification information of the domain name is returned. To verify your ownership of the domain name, see [Ownership Verification](https://intl.cloud.tencent.com/document/product/1552/70789?from_cn_redirect=1).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INVALIDPARAMETER_CONFLICTHOSTORIGIN = "InvalidParameter.ConflictHostOrigin"
INVALIDPARAMETER_ERRINVALIDACTIONPARAM = "InvalidParameter.ErrInvalidActionParam"
INVALIDPARAMETER_INVALIDACCELERATETYPE = "InvalidParameter.InvalidAccelerateType"
INVALIDPARAMETER_INVALIDAWSPRIVATEACCESS = "InvalidParameter.InvalidAwsPrivateAccess"
INVALIDPARAMETER_INVALIDAWSREGION = "InvalidParameter.InvalidAwsRegion"
INVALIDPARAMETER_INVALIDCLIENTIPORIGIN = "InvalidParameter.InvalidClientIpOrigin"
INVALIDPARAMETER_INVALIDIPV6SWITCH = "InvalidParameter.InvalidIpv6Switch"
INVALIDPARAMETER_INVALIDORIGIN = "InvalidParameter.InvalidOrigin"
INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_INVALIDPRIVATEACCESSPARAMS = "InvalidParameter.InvalidPrivateAccessParams"
INVALIDPARAMETER_INVALIDPRIVATEACCESSSWITCH = "InvalidParameter.InvalidPrivateAccessSwitch"
INVALIDPARAMETER_INVALIDQUICBILLING = "InvalidParameter.InvalidQuicBilling"
INVALIDPARAMETER_INVALIDSERVERNAME = "InvalidParameter.InvalidServerName"
INVALIDPARAMETER_INVALIDSTANDARDDEBUGCLIENTIP = "InvalidParameter.InvalidStandardDebugClientIp"
INVALIDPARAMETER_INVALIDWEBSOCKETTIMEOUT = "InvalidParameter.InvalidWebSocketTimeout"
INVALIDPARAMETER_POSTMAXSIZELIMITEXCEEDED = "InvalidParameter.PostMaxSizeLimitExceeded"
INVALIDPARAMETER_SPACENOTBINDORIGIN = "InvalidParameter.SpaceNotBindOrigin"
INVALIDPARAMETER_ZONEISGRAYPUBLISHING = "InvalidParameter.ZoneIsGrayPublishing"
INVALIDPARAMETERVALUE_CONFLICTRECORD = "InvalidParameterValue.ConflictRecord"
INVALIDPARAMETERVALUE_CONFLICTWITHDNSSEC = "InvalidParameterValue.ConflictWithDNSSEC"
INVALIDPARAMETERVALUE_CONFLICTWITHDOMAIN = "InvalidParameterValue.ConflictWithDomain"
INVALIDPARAMETERVALUE_CONFLICTWITHNSRECORD = "InvalidParameterValue.ConflictWithNSRecord"
INVALIDPARAMETERVALUE_CONTENTSAMEASNAME = "InvalidParameterValue.ContentSameAsName"
INVALIDPARAMETERVALUE_DOMAINNOTMATCHZONE = "InvalidParameterValue.DomainNotMatchZone"
INVALIDPARAMETERVALUE_INVALIDDNSCONTENT = "InvalidParameterValue.InvalidDNSContent"
INVALIDPARAMETERVALUE_INVALIDDNSNAME = "InvalidParameterValue.InvalidDNSName"
INVALIDPARAMETERVALUE_INVALIDDOMAINNAME = "InvalidParameterValue.InvalidDomainName"
INVALIDPARAMETERVALUE_INVALIDPROXYORIGIN = "InvalidParameterValue.InvalidProxyOrigin"
INVALIDPARAMETERVALUE_ORIGINGROUPNOTEXISTS = "InvalidParameterValue.OriginGroupNotExists"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ACCELERATEMAINLANDDISABLE = "OperationDenied.AccelerateMainlandDisable"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"
OPERATIONDENIED_DOMAINNOICP = "OperationDenied.DomainNoICP"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_INVALIDADVANCEDDEFENSEZONEAREA = "OperationDenied.InvalidAdvancedDefenseZoneArea"
OPERATIONDENIED_LOADBALANCESTATUSNOTINONLINE = "OperationDenied.LoadBalanceStatusNotInOnline"
OPERATIONDENIED_RECORDISFORBIDDEN = "OperationDenied.RecordIsForbidden"
OPERATIONDENIED_RESOURCELOCKEDTEMPORARY = "OperationDenied.ResourceLockedTemporary"
OPERATIONDENIED_VERSIONCONTROLISGRAYING = "OperationDenied.VersionControlIsGraying"
RESOURCEINUSE = "ResourceInUse"
RESOURCEINUSE_DNSRECORD = "ResourceInUse.DnsRecord"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE_DOMAINALREADYEXISTS = "ResourceUnavailable.DomainAlreadyExists"
RESOURCESSOLDOUT_L7LACKOFRESOURCES = "ResourcesSoldOut.L7LackOfResources"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) CreateAliasDomain 

func (c *Client) CreateAliasDomain(request *CreateAliasDomainRequest) (response *CreateAliasDomainResponse, err error)

CreateAliasDomain This API is used to create an alias domain name.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_CERTIFICATENOTFOUND = "FailedOperation.CertificateNotFound"
INTERNALERROR = "InternalError"
INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INVALIDPARAMETER_ALIASDOMAINNOTSUPPORTSMCERT = "InvalidParameter.AliasDomainNotSupportSMCert"
INVALIDPARAMETER_CERTNOTMATCHDOMAIN = "InvalidParameter.CertNotMatchDomain"
INVALIDPARAMETER_INVALIDHTTPSCERTINFO = "InvalidParameter.InvalidHttpsCertInfo"
INVALIDPARAMETER_INVALIDPARAMETER = "InvalidParameter.InvalidParameter"
INVALIDPARAMETER_INVALIDREQUESTHEADERNAME = "InvalidParameter.InvalidRequestHeaderName"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
INVALIDPARAMETERVALUE_INVALIDALIASDOMAINNAME = "InvalidParameterValue.InvalidAliasDomainName"
INVALIDPARAMETERVALUE_INVALIDALIASNAMESUFFIX = "InvalidParameterValue.InvalidAliasNameSuffix"
LIMITEXCEEDED = "LimitExceeded"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_DOMAINISBLOCKED = "OperationDenied.DomainIsBlocked"
OPERATIONDENIED_DOMAINNOICP = "OperationDenied.DomainNoICP"
OPERATIONDENIED_VERSIONCONTROLLOCKED = "OperationDenied.VersionControlLocked"
RESOURCEINUSE_ALIASNAME = "ResourceInUse.AliasName"
RESOURCEINUSE_DUPLICATENAME = "ResourceInUse.DuplicateName"
RESOURCEINUSE_ZONE = "ResourceInUse.Zone"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE_DOMAINALREADYEXISTS = "ResourceUnavailable.DomainAlreadyExists"
UNAUTHORIZEDOPERATION = "UnauthorizedOperation"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNSUPPORTEDOPERATION_TARGETNAMEORIGINTYPECOS = "UnsupportedOperation.TargetNameOriginTypeCos"

func (*Client) CreateAliasDomainWithContext 

func (c *Client) CreateAliasDomainWithContext(ctx context.Context, request *CreateAliasDomainRequest) (response *CreateAliasDomainResponse, err error)

CreateAliasDomain This API is used to create an alias domain name.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_CERTIFICATENOTFOUND = "FailedOperation.CertificateNotFound"
INTERNALERROR = "InternalError"
INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INVALIDPARAMETER_ALIASDOMAINNOTSUPPORTSMCERT = "InvalidParameter.AliasDomainNotSupportSMCert"
INVALIDPARAMETER_CERTNOTMATCHDOMAIN = "InvalidParameter.CertNotMatchDomain"
INVALIDPARAMETER_INVALIDHTTPSCERTINFO = "InvalidParameter.InvalidHttpsCertInfo"
INVALIDPARAMETER_INVALIDPARAMETER = "InvalidParameter.InvalidParameter"
INVALIDPARAMETER_INVALIDREQUESTHEADERNAME = "InvalidParameter.InvalidRequestHeaderName"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
INVALIDPARAMETERVALUE_INVALIDALIASDOMAINNAME = "InvalidParameterValue.InvalidAliasDomainName"
INVALIDPARAMETERVALUE_INVALIDALIASNAMESUFFIX = "InvalidParameterValue.InvalidAliasNameSuffix"
LIMITEXCEEDED = "LimitExceeded"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_DOMAINISBLOCKED = "OperationDenied.DomainIsBlocked"
OPERATIONDENIED_DOMAINNOICP = "OperationDenied.DomainNoICP"
OPERATIONDENIED_VERSIONCONTROLLOCKED = "OperationDenied.VersionControlLocked"
RESOURCEINUSE_ALIASNAME = "ResourceInUse.AliasName"
RESOURCEINUSE_DUPLICATENAME = "ResourceInUse.DuplicateName"
RESOURCEINUSE_ZONE = "ResourceInUse.Zone"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE_DOMAINALREADYEXISTS = "ResourceUnavailable.DomainAlreadyExists"
UNAUTHORIZEDOPERATION = "UnauthorizedOperation"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNSUPPORTEDOPERATION_TARGETNAMEORIGINTYPECOS = "UnsupportedOperation.TargetNameOriginTypeCos"

func (*Client) CreateApplicationProxy 

func (c *Client) CreateApplicationProxy(request *CreateApplicationProxyRequest) (response *CreateApplicationProxyResponse, err error)

CreateApplicationProxy This API is on an earlier version. If you want to call it, please switch to the latest version [CreateL4Proxy] (https://intl.cloud.tencent.com/document/product/1552/103417?from_cn_redirect=1).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_PARAMETERERROR = "InvalidParameter.ParameterError"
INVALIDPARAMETER_PROXYNAMEDUPLICATING = "InvalidParameter.ProxyNameDuplicating"
INVALIDPARAMETER_PROXYNAMENOTMATCHED = "InvalidParameter.ProxyNameNotMatched"
LIMITEXCEEDED = "LimitExceeded"
LIMITEXCEEDED_USERQUOTALIMITED = "LimitExceeded.UserQuotaLimited"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_PLATTYPEIPACCELERATEMAINLANDNOTSUPPORT = "OperationDenied.PlatTypeIPAccelerateMainlandNotSupport"
OPERATIONDENIED_ZONENOTACTIVE = "OperationDenied.ZoneNotActive"
RESOURCEINSUFFICIENT = "ResourceInsufficient"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) CreateApplicationProxyRule 

func (c *Client) CreateApplicationProxyRule(request *CreateApplicationProxyRuleRequest) (response *CreateApplicationProxyRuleResponse, err error)

CreateApplicationProxyRule This API is on an earlier version. If you want to call it, please switch to the latest version. For details, see [CreateL4ProxyRules] (https://intl.cloud.tencent.com/document/product/1552/103416?from_cn_redirect=1).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_INVALIDRULEPROTO = "InvalidParameter.InvalidRuleProto"
INVALIDPARAMETER_PARAMETERERROR = "InvalidParameter.ParameterError"
INVALIDPARAMETER_RULEORIGINFORMATERROR = "InvalidParameter.RuleOriginFormatError"
INVALIDPARAMETER_RULEORIGINMULTIDOMAIN = "InvalidParameter.RuleOriginMultiDomain"
INVALIDPARAMETER_RULEORIGINPORTINTEGER = "InvalidParameter.RuleOriginPortInteger"
INVALIDPARAMETER_RULEORIGINVALUEERROR = "InvalidParameter.RuleOriginValueError"
INVALIDPARAMETER_RULEPORTDUPLICATING = "InvalidParameter.RulePortDuplicating"
INVALIDPARAMETER_RULEPORTGROUP = "InvalidParameter.RulePortGroup"
INVALIDPARAMETER_RULEPORTINTEGER = "InvalidParameter.RulePortInteger"
OPERATIONDENIED = "OperationDenied"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) CreateApplicationProxyRuleWithContext 

func (c *Client) CreateApplicationProxyRuleWithContext(ctx context.Context, request *CreateApplicationProxyRuleRequest) (response *CreateApplicationProxyRuleResponse, err error)

CreateApplicationProxyRule This API is on an earlier version. If you want to call it, please switch to the latest version. For details, see [CreateL4ProxyRules] (https://intl.cloud.tencent.com/document/product/1552/103416?from_cn_redirect=1).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_INVALIDRULEPROTO = "InvalidParameter.InvalidRuleProto"
INVALIDPARAMETER_PARAMETERERROR = "InvalidParameter.ParameterError"
INVALIDPARAMETER_RULEORIGINFORMATERROR = "InvalidParameter.RuleOriginFormatError"
INVALIDPARAMETER_RULEORIGINMULTIDOMAIN = "InvalidParameter.RuleOriginMultiDomain"
INVALIDPARAMETER_RULEORIGINPORTINTEGER = "InvalidParameter.RuleOriginPortInteger"
INVALIDPARAMETER_RULEORIGINVALUEERROR = "InvalidParameter.RuleOriginValueError"
INVALIDPARAMETER_RULEPORTDUPLICATING = "InvalidParameter.RulePortDuplicating"
INVALIDPARAMETER_RULEPORTGROUP = "InvalidParameter.RulePortGroup"
INVALIDPARAMETER_RULEPORTINTEGER = "InvalidParameter.RulePortInteger"
OPERATIONDENIED = "OperationDenied"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) CreateApplicationProxyWithContext 

func (c *Client) CreateApplicationProxyWithContext(ctx context.Context, request *CreateApplicationProxyRequest) (response *CreateApplicationProxyResponse, err error)

CreateApplicationProxy This API is on an earlier version. If you want to call it, please switch to the latest version [CreateL4Proxy] (https://intl.cloud.tencent.com/document/product/1552/103417?from_cn_redirect=1).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_PARAMETERERROR = "InvalidParameter.ParameterError"
INVALIDPARAMETER_PROXYNAMEDUPLICATING = "InvalidParameter.ProxyNameDuplicating"
INVALIDPARAMETER_PROXYNAMENOTMATCHED = "InvalidParameter.ProxyNameNotMatched"
LIMITEXCEEDED = "LimitExceeded"
LIMITEXCEEDED_USERQUOTALIMITED = "LimitExceeded.UserQuotaLimited"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_PLATTYPEIPACCELERATEMAINLANDNOTSUPPORT = "OperationDenied.PlatTypeIPAccelerateMainlandNotSupport"
OPERATIONDENIED_ZONENOTACTIVE = "OperationDenied.ZoneNotActive"
RESOURCEINSUFFICIENT = "ResourceInsufficient"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) CreateCLSIndex 

func (c *Client) CreateCLSIndex(request *CreateCLSIndexRequest) (response *CreateCLSIndexResponse, err error)

CreateCLSIndex This API is used to create key-value indexes for relevant delivered log fields in the corresponding Tencent Cloud CLS log topic for a specified real-time log delivery task (task-id). If such indexes have been created in CLS, this API will append indexes through merging.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_CREATECLSLOGSETFAILED = "FailedOperation.CreateClsLogSetFailed"

func (*Client) CreateCLSIndexWithContext 

func (c *Client) CreateCLSIndexWithContext(ctx context.Context, request *CreateCLSIndexRequest) (response *CreateCLSIndexResponse, err error)

CreateCLSIndex This API is used to create key-value indexes for relevant delivered log fields in the corresponding Tencent Cloud CLS log topic for a specified real-time log delivery task (task-id). If such indexes have been created in CLS, this API will append indexes through merging.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_CREATECLSLOGSETFAILED = "FailedOperation.CreateClsLogSetFailed"

func (*Client) CreateConfigGroupVersion 

func (c *Client) CreateConfigGroupVersion(request *CreateConfigGroupVersionRequest) (response *CreateConfigGroupVersionResponse, err error)

CreateConfigGroupVersion This API is used to create a new version for the specified configuration group in version management mode. The version management feature is currently undergoing beta testing and is accessible only to users on the whitelist.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_CONFIGCONDITIONSYNTAXERROR = "FailedOperation.ConfigConditionSyntaxError"
FAILEDOPERATION_CONFIGCONDITIONUNKNOWNTARGET = "FailedOperation.ConfigConditionUnknownTarget"
FAILEDOPERATION_CONFIGCONDITIONVALUEEMPTYERROR = "FailedOperation.ConfigConditionValueEmptyError"
FAILEDOPERATION_CONFIGFIELDTYPEERROR = "FailedOperation.ConfigFieldTypeError"
FAILEDOPERATION_CONFIGFORMATERROR = "FailedOperation.ConfigFormatError"
FAILEDOPERATION_CONFIGMALFORMEDCONTENT = "FailedOperation.ConfigMalformedContent"
FAILEDOPERATION_CONFIGPARAMVALIDATEERRORS = "FailedOperation.ConfigParamValidateErrors"
FAILEDOPERATION_CONFIGUNKNOWNFIELD = "FailedOperation.ConfigUnknownField"
FAILEDOPERATION_CONFIGUNSUPPORTEDFORMATVERSION = "FailedOperation.ConfigUnsupportedFormatVersion"
FAILEDOPERATION_MISSINGCONFIGCHUNK = "FailedOperation.MissingConfigChunk"
FAILEDOPERATION_UNKNOWNCONFIGGROUPTYPE = "FailedOperation.UnknownConfigGroupType"
INVALIDPARAMETER = "InvalidParameter"
INVALIDPARAMETER_DUPLICATERULE = "InvalidParameter.DuplicateRule"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADVALUE = "InvalidParameter.ErrInvalidConditionValueBadValue"
INVALIDPARAMETER_INVALIDCACHEKEYQUERYSTRINGACTION = "InvalidParameter.InvalidCacheKeyQueryStringAction"
INVALIDPARAMETER_INVALIDCONDITIONS = "InvalidParameter.InvalidConditions"
INVALIDPARAMETER_INVALIDDYNAMICROUTINE = "InvalidParameter.InvalidDynamicRoutine"
INVALIDPARAMETER_INVALIDIPV6SWITCH = "InvalidParameter.InvalidIpv6Switch"
INVALIDPARAMETER_INVALIDMAXAGEFOLLOWORIGIN = "InvalidParameter.InvalidMaxAgeFollowOrigin"
INVALIDPARAMETER_INVALIDSTANDARDDEBUG = "InvalidParameter.InvalidStandardDebug"
INVALIDPARAMETER_POSTMAXSIZELIMITEXCEEDED = "InvalidParameter.PostMaxSizeLimitExceeded"
INVALIDPARAMETER_STATUSCODECACHEINVALIDSTATUSCODE = "InvalidParameter.StatusCodeCacheInvalidStatusCode"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
LIMITEXCEEDED_RULELIMITEXCEEDED = "LimitExceeded.RuleLimitExceeded"
MISSINGPARAMETER = "MissingParameter"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ACCELERATEMAINLANDIPV6CONFLICT = "OperationDenied.AccelerateMainlandIpv6Conflict"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_NOTINVERSIONCONTROLWHITELIST = "OperationDenied.NotInVersionControlWhiteList"
OPERATIONDENIED_OWNERSHIPVERIFICATIONNOTPASSED = "OperationDenied.OwnershipVerificationNotPassed"
OPERATIONDENIED_VERSIONCONTROLLOCKED = "OperationDenied.VersionControlLocked"
OPERATIONDENIED_WORKMODENOTINVERSIONCONTROL = "OperationDenied.WorkModeNotInVersionControl"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE_FUNCTIONNOTFOUND = "ResourceUnavailable.FunctionNotFound"

func (*Client) CreateConfigGroupVersionWithContext 

func (c *Client) CreateConfigGroupVersionWithContext(ctx context.Context, request *CreateConfigGroupVersionRequest) (response *CreateConfigGroupVersionResponse, err error)

CreateConfigGroupVersion This API is used to create a new version for the specified configuration group in version management mode. The version management feature is currently undergoing beta testing and is accessible only to users on the whitelist.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_CONFIGCONDITIONSYNTAXERROR = "FailedOperation.ConfigConditionSyntaxError"
FAILEDOPERATION_CONFIGCONDITIONUNKNOWNTARGET = "FailedOperation.ConfigConditionUnknownTarget"
FAILEDOPERATION_CONFIGCONDITIONVALUEEMPTYERROR = "FailedOperation.ConfigConditionValueEmptyError"
FAILEDOPERATION_CONFIGFIELDTYPEERROR = "FailedOperation.ConfigFieldTypeError"
FAILEDOPERATION_CONFIGFORMATERROR = "FailedOperation.ConfigFormatError"
FAILEDOPERATION_CONFIGMALFORMEDCONTENT = "FailedOperation.ConfigMalformedContent"
FAILEDOPERATION_CONFIGPARAMVALIDATEERRORS = "FailedOperation.ConfigParamValidateErrors"
FAILEDOPERATION_CONFIGUNKNOWNFIELD = "FailedOperation.ConfigUnknownField"
FAILEDOPERATION_CONFIGUNSUPPORTEDFORMATVERSION = "FailedOperation.ConfigUnsupportedFormatVersion"
FAILEDOPERATION_MISSINGCONFIGCHUNK = "FailedOperation.MissingConfigChunk"
FAILEDOPERATION_UNKNOWNCONFIGGROUPTYPE = "FailedOperation.UnknownConfigGroupType"
INVALIDPARAMETER = "InvalidParameter"
INVALIDPARAMETER_DUPLICATERULE = "InvalidParameter.DuplicateRule"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADVALUE = "InvalidParameter.ErrInvalidConditionValueBadValue"
INVALIDPARAMETER_INVALIDCACHEKEYQUERYSTRINGACTION = "InvalidParameter.InvalidCacheKeyQueryStringAction"
INVALIDPARAMETER_INVALIDCONDITIONS = "InvalidParameter.InvalidConditions"
INVALIDPARAMETER_INVALIDDYNAMICROUTINE = "InvalidParameter.InvalidDynamicRoutine"
INVALIDPARAMETER_INVALIDIPV6SWITCH = "InvalidParameter.InvalidIpv6Switch"
INVALIDPARAMETER_INVALIDMAXAGEFOLLOWORIGIN = "InvalidParameter.InvalidMaxAgeFollowOrigin"
INVALIDPARAMETER_INVALIDSTANDARDDEBUG = "InvalidParameter.InvalidStandardDebug"
INVALIDPARAMETER_POSTMAXSIZELIMITEXCEEDED = "InvalidParameter.PostMaxSizeLimitExceeded"
INVALIDPARAMETER_STATUSCODECACHEINVALIDSTATUSCODE = "InvalidParameter.StatusCodeCacheInvalidStatusCode"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
LIMITEXCEEDED_RULELIMITEXCEEDED = "LimitExceeded.RuleLimitExceeded"
MISSINGPARAMETER = "MissingParameter"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ACCELERATEMAINLANDIPV6CONFLICT = "OperationDenied.AccelerateMainlandIpv6Conflict"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_NOTINVERSIONCONTROLWHITELIST = "OperationDenied.NotInVersionControlWhiteList"
OPERATIONDENIED_OWNERSHIPVERIFICATIONNOTPASSED = "OperationDenied.OwnershipVerificationNotPassed"
OPERATIONDENIED_VERSIONCONTROLLOCKED = "OperationDenied.VersionControlLocked"
OPERATIONDENIED_WORKMODENOTINVERSIONCONTROL = "OperationDenied.WorkModeNotInVersionControl"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE_FUNCTIONNOTFOUND = "ResourceUnavailable.FunctionNotFound"

func (*Client) CreateCustomizeErrorPage 

func (c *Client) CreateCustomizeErrorPage(request *CreateCustomizeErrorPageRequest) (response *CreateCustomizeErrorPageResponse, err error)

CreateCustomizeErrorPage This API is used to create a custom response page.

error code that may be returned: 

INVALIDPARAMETERVALUE_CONTENTTYPENOTMATCH = "InvalidParameterValue.ContentTypeNotMatch"
INVALIDPARAMETERVALUE_PAGENAMEALREADYEXIST = "InvalidParameterValue.PageNameAlreadyExist"

func (*Client) CreateCustomizeErrorPageWithContext 

func (c *Client) CreateCustomizeErrorPageWithContext(ctx context.Context, request *CreateCustomizeErrorPageRequest) (response *CreateCustomizeErrorPageResponse, err error)

CreateCustomizeErrorPage This API is used to create a custom response page.

error code that may be returned: 

INVALIDPARAMETERVALUE_CONTENTTYPENOTMATCH = "InvalidParameterValue.ContentTypeNotMatch"
INVALIDPARAMETERVALUE_PAGENAMEALREADYEXIST = "InvalidParameterValue.PageNameAlreadyExist"

func (*Client) CreateFunction 

func (c *Client) CreateFunction(request *CreateFunctionRequest) (response *CreateFunctionResponse, err error)

CreateFunction This API is used to create and deploy an edge function to EdgeOne edge nodes.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_FUNCTIONDEPLOYING = "FailedOperation.FunctionDeploying"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_BADCONTENT = "InvalidParameter.BadContent"
INVALIDPARAMETER_BADFUNCTIONNAME = "InvalidParameter.BadFunctionName"
INVALIDPARAMETER_CONTENTEXCEEDSLIMIT = "InvalidParameter.ContentExceedsLimit"
INVALIDPARAMETER_FUNCTIONNAMECONFLICT = "InvalidParameter.FunctionNameConflict"
INVALIDPARAMETER_LENGTHEXCEEDSLIMIT = "InvalidParameter.LengthExceedsLimit"
LIMITEXCEEDED_FUNCTIONLIMITEXCEEDED = "LimitExceeded.FunctionLimitExceeded"
OPERATIONDENIED_VERSIONCONTROLLOCKED = "OperationDenied.VersionControlLocked"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) CreateFunctionRule 

func (c *Client) CreateFunctionRule(request *CreateFunctionRuleRequest) (response *CreateFunctionRuleResponse, err error)

CreateFunctionRule This API is used to create a trigger rule for an edge function.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_RULEOPERATIONCONFLICT = "FailedOperation.RuleOperationConflict"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_DUPLICATERULE = "InvalidParameter.DuplicateRule"
INVALIDPARAMETER_INVALIDCONDITIONS = "InvalidParameter.InvalidConditions"
LIMITEXCEEDED_RULELIMITEXCEEDED = "LimitExceeded.RuleLimitExceeded"
OPERATIONDENIED_VERSIONCONTROLLOCKED = "OperationDenied.VersionControlLocked"
RESOURCEUNAVAILABLE_FUNCTIONNOTFOUND = "ResourceUnavailable.FunctionNotFound"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

func (*Client) CreateFunctionRuleWithContext 

func (c *Client) CreateFunctionRuleWithContext(ctx context.Context, request *CreateFunctionRuleRequest) (response *CreateFunctionRuleResponse, err error)

CreateFunctionRule This API is used to create a trigger rule for an edge function.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_RULEOPERATIONCONFLICT = "FailedOperation.RuleOperationConflict"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_DUPLICATERULE = "InvalidParameter.DuplicateRule"
INVALIDPARAMETER_INVALIDCONDITIONS = "InvalidParameter.InvalidConditions"
LIMITEXCEEDED_RULELIMITEXCEEDED = "LimitExceeded.RuleLimitExceeded"
OPERATIONDENIED_VERSIONCONTROLLOCKED = "OperationDenied.VersionControlLocked"
RESOURCEUNAVAILABLE_FUNCTIONNOTFOUND = "ResourceUnavailable.FunctionNotFound"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

func (*Client) CreateFunctionWithContext 

func (c *Client) CreateFunctionWithContext(ctx context.Context, request *CreateFunctionRequest) (response *CreateFunctionResponse, err error)

CreateFunction This API is used to create and deploy an edge function to EdgeOne edge nodes.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_FUNCTIONDEPLOYING = "FailedOperation.FunctionDeploying"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_BADCONTENT = "InvalidParameter.BadContent"
INVALIDPARAMETER_BADFUNCTIONNAME = "InvalidParameter.BadFunctionName"
INVALIDPARAMETER_CONTENTEXCEEDSLIMIT = "InvalidParameter.ContentExceedsLimit"
INVALIDPARAMETER_FUNCTIONNAMECONFLICT = "InvalidParameter.FunctionNameConflict"
INVALIDPARAMETER_LENGTHEXCEEDSLIMIT = "InvalidParameter.LengthExceedsLimit"
LIMITEXCEEDED_FUNCTIONLIMITEXCEEDED = "LimitExceeded.FunctionLimitExceeded"
OPERATIONDENIED_VERSIONCONTROLLOCKED = "OperationDenied.VersionControlLocked"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) CreateL4Proxy 

func (c *Client) CreateL4Proxy(request *CreateL4ProxyRequest) (response *CreateL4ProxyResponse, err error)

CreateL4Proxy This API is used to create Layer 4 proxy instances.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INVALIDPARAMETER_PROXYNAMEDUPLICATING = "InvalidParameter.ProxyNameDuplicating"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ACCELERATEMAINLANDDISABLE = "OperationDenied.AccelerateMainlandDisable"
OPERATIONDENIED_ACCELERATEMAINLANDIPV6CONFLICT = "OperationDenied.AccelerateMainlandIpv6Conflict"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_IPV6ADVANCEDCONFLICT = "OperationDenied.Ipv6AdvancedConflict"
OPERATIONDENIED_IPV6STATICIPCONFLICT = "OperationDenied.Ipv6StaticIpConflict"
OPERATIONDENIED_L4LACKOFRESOURCES = "OperationDenied.L4LackOfResources"
OPERATIONDENIED_MSGIPV6ADVANCEDCONFLICT = "OperationDenied.MsgIpv6AdvancedConflict"
OPERATIONDENIED_STATICIPAREACONFLICT = "OperationDenied.StaticIpAreaConflict"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) CreateL4ProxyRules 

func (c *Client) CreateL4ProxyRules(request *CreateL4ProxyRulesRequest) (response *CreateL4ProxyRulesResponse, err error)

CreateL4ProxyRules This API is used to create Layer 4 proxy instance rules, supporting both individual and batch creation.

error code that may be returned: 

INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_INVALIDORIGINVALUE = "InvalidParameter.InvalidOriginValue"
INVALIDPARAMETER_RULEPORTDUPLICATING = "InvalidParameter.RulePortDuplicating"
LIMITEXCEEDED_PROXYRULESLIMITEXCEEDED = "LimitExceeded.ProxyRulesLimitExceeded"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_L4PORTLACKOFRESOURCES = "OperationDenied.L4PortLackOfResources"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) CreateL4ProxyRulesWithContext 

func (c *Client) CreateL4ProxyRulesWithContext(ctx context.Context, request *CreateL4ProxyRulesRequest) (response *CreateL4ProxyRulesResponse, err error)

CreateL4ProxyRules This API is used to create Layer 4 proxy instance rules, supporting both individual and batch creation.

error code that may be returned: 

INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_INVALIDORIGINVALUE = "InvalidParameter.InvalidOriginValue"
INVALIDPARAMETER_RULEPORTDUPLICATING = "InvalidParameter.RulePortDuplicating"
LIMITEXCEEDED_PROXYRULESLIMITEXCEEDED = "LimitExceeded.ProxyRulesLimitExceeded"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_L4PORTLACKOFRESOURCES = "OperationDenied.L4PortLackOfResources"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) CreateL4ProxyWithContext 

func (c *Client) CreateL4ProxyWithContext(ctx context.Context, request *CreateL4ProxyRequest) (response *CreateL4ProxyResponse, err error)

CreateL4Proxy This API is used to create Layer 4 proxy instances.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INVALIDPARAMETER_PROXYNAMEDUPLICATING = "InvalidParameter.ProxyNameDuplicating"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ACCELERATEMAINLANDDISABLE = "OperationDenied.AccelerateMainlandDisable"
OPERATIONDENIED_ACCELERATEMAINLANDIPV6CONFLICT = "OperationDenied.AccelerateMainlandIpv6Conflict"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_IPV6ADVANCEDCONFLICT = "OperationDenied.Ipv6AdvancedConflict"
OPERATIONDENIED_IPV6STATICIPCONFLICT = "OperationDenied.Ipv6StaticIpConflict"
OPERATIONDENIED_L4LACKOFRESOURCES = "OperationDenied.L4LackOfResources"
OPERATIONDENIED_MSGIPV6ADVANCEDCONFLICT = "OperationDenied.MsgIpv6AdvancedConflict"
OPERATIONDENIED_STATICIPAREACONFLICT = "OperationDenied.StaticIpAreaConflict"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) CreateLoadBalancer 

func (c *Client) CreateLoadBalancer(request *CreateLoadBalancerRequest) (response *CreateLoadBalancerResponse, err error)

CreateLoadBalancer This API is used to create a LoadBalancer. For details, see [Quickly Create Load Balancers](https://intl.cloud.tencent.com/document/product/1552/104223?from_cn_redirect=1). The load balancing feature is in beta test. If you need to use it, [contact us](https://intl.cloud.tencent.com/online?from_cn_redirect=1-service).

error code that may be returned: 

INVALIDPARAMETER_LOADBALANCERNAMEREPEATED = "InvalidParameter.LoadBalancerNameRepeated"
INVALIDPARAMETER_ORIGINGROUPTYPECANNOTMATCHLBTYPE = "InvalidParameter.OriginGroupTypeCanNotMatchLBType"
INVALIDPARAMETER_SOMEORIGINGROUPNOTEXIST = "InvalidParameter.SomeOriginGroupNotExist"
LIMITEXCEEDED_LOADBALANCINGCOUNTLIMITEXCEEDED = "LimitExceeded.LoadBalancingCountLimitExceeded"

func (*Client) CreateLoadBalancerWithContext 

func (c *Client) CreateLoadBalancerWithContext(ctx context.Context, request *CreateLoadBalancerRequest) (response *CreateLoadBalancerResponse, err error)

CreateLoadBalancer This API is used to create a LoadBalancer. For details, see [Quickly Create Load Balancers](https://intl.cloud.tencent.com/document/product/1552/104223?from_cn_redirect=1). The load balancing feature is in beta test. If you need to use it, [contact us](https://intl.cloud.tencent.com/online?from_cn_redirect=1-service).

error code that may be returned: 

INVALIDPARAMETER_LOADBALANCERNAMEREPEATED = "InvalidParameter.LoadBalancerNameRepeated"
INVALIDPARAMETER_ORIGINGROUPTYPECANNOTMATCHLBTYPE = "InvalidParameter.OriginGroupTypeCanNotMatchLBType"
INVALIDPARAMETER_SOMEORIGINGROUPNOTEXIST = "InvalidParameter.SomeOriginGroupNotExist"
LIMITEXCEEDED_LOADBALANCINGCOUNTLIMITEXCEEDED = "LimitExceeded.LoadBalancingCountLimitExceeded"

func (*Client) CreateOriginGroup 

func (c *Client) CreateOriginGroup(request *CreateOriginGroupRequest) (response *CreateOriginGroupResponse, err error)

CreateOriginGroup This API is used to create an origin group for easy management. The created origin server group can be used for **adding acceleration domain names** and **layer-4 proxy configuration**.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INVALIDPARAMETER_HOSTHEADERINVALID = "InvalidParameter.HostHeaderInvalid"
INVALIDPARAMETER_INVALIDAWSREGION = "InvalidParameter.InvalidAwsRegion"
INVALIDPARAMETER_INVALIDORIGINGROUPTYPE = "InvalidParameter.InvalidOriginGroupType"
INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_ORIGINNAMEEXISTS = "InvalidParameter.OriginNameExists"
INVALIDPARAMETER_ORIGINRECORDFORMATERROR = "InvalidParameter.OriginRecordFormatError"
INVALIDPARAMETER_ORIGINRECORDWEIGHTVALUE = "InvalidParameter.OriginRecordWeightValue"
INVALIDPARAMETER_ORIGINTHIRDPARTYPARAMFORMATERROR = "InvalidParameter.OriginThirdPartyParamFormatError"
LIMITEXCEEDED = "LimitExceeded"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_LOADBALANCINGZONEISNOTACTIVE = "OperationDenied.LoadBalancingZoneIsNotActive"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"

func (*Client) CreateOriginGroupWithContext 

func (c *Client) CreateOriginGroupWithContext(ctx context.Context, request *CreateOriginGroupRequest) (response *CreateOriginGroupResponse, err error)

CreateOriginGroup This API is used to create an origin group for easy management. The created origin server group can be used for **adding acceleration domain names** and **layer-4 proxy configuration**.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INVALIDPARAMETER_HOSTHEADERINVALID = "InvalidParameter.HostHeaderInvalid"
INVALIDPARAMETER_INVALIDAWSREGION = "InvalidParameter.InvalidAwsRegion"
INVALIDPARAMETER_INVALIDORIGINGROUPTYPE = "InvalidParameter.InvalidOriginGroupType"
INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_ORIGINNAMEEXISTS = "InvalidParameter.OriginNameExists"
INVALIDPARAMETER_ORIGINRECORDFORMATERROR = "InvalidParameter.OriginRecordFormatError"
INVALIDPARAMETER_ORIGINRECORDWEIGHTVALUE = "InvalidParameter.OriginRecordWeightValue"
INVALIDPARAMETER_ORIGINTHIRDPARTYPARAMFORMATERROR = "InvalidParameter.OriginThirdPartyParamFormatError"
LIMITEXCEEDED = "LimitExceeded"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_LOADBALANCINGZONEISNOTACTIVE = "OperationDenied.LoadBalancingZoneIsNotActive"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"

func (*Client) CreatePlan 

func (c *Client) CreatePlan(request *CreatePlanRequest) (response *CreatePlanResponse, err error)

CreatePlan If you need to use the EdgeOne product, you must create a billing plan through this interface.

> After creating a plan, you need to complete the process of creating a site and binding the plan through [CreateZone](https://intl.cloud.tencent.com/document/product/1552/80719?from_cn_redirect=1), so that the EdgeOne can provide services properly.

error code that may be returned: 

FAILEDOPERATION_INSUFFICIENTACCOUNTBALANCE = "FailedOperation.InsufficientAccountBalance"
INVALIDPARAMETER_INVALIDAUTOUSEVOUCHER = "InvalidParameter.InvalidAutoUseVoucher"
INVALIDPARAMETER_INVALIDPERIOD = "InvalidParameter.InvalidPeriod"
INVALIDPARAMETER_INVALIDPLANTYPE = "InvalidParameter.InvalidPlanType"
INVALIDPARAMETER_INVALIDRENEWFLAG = "InvalidParameter.InvalidRenewFlag"
OPERATIONDENIED_PLEASECONTACTBUSINESSPERSONNEL = "OperationDenied.PleaseContactBusinessPersonnel"

func (*Client) CreatePlanForZone 

func (c *Client) CreatePlanForZone(request *CreatePlanForZoneRequest) (response *CreatePlanForZoneResponse, err error)

CreatePlanForZone This API is used to purchase a plan for a new site.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_INSUFFICIENTACCOUNTBALANCE = "FailedOperation.InsufficientAccountBalance"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INVALIDPARAMETER_ZONEHASBEENBOUND = "InvalidParameter.ZoneHasBeenBound"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_DOMAINNOICP = "OperationDenied.DomainNoICP"

func (*Client) CreatePlanForZoneWithContext 

func (c *Client) CreatePlanForZoneWithContext(ctx context.Context, request *CreatePlanForZoneRequest) (response *CreatePlanForZoneResponse, err error)

CreatePlanForZone This API is used to purchase a plan for a new site.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_INSUFFICIENTACCOUNTBALANCE = "FailedOperation.InsufficientAccountBalance"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INVALIDPARAMETER_ZONEHASBEENBOUND = "InvalidParameter.ZoneHasBeenBound"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_DOMAINNOICP = "OperationDenied.DomainNoICP"

func (*Client) CreatePlanWithContext 

func (c *Client) CreatePlanWithContext(ctx context.Context, request *CreatePlanRequest) (response *CreatePlanResponse, err error)

CreatePlan If you need to use the EdgeOne product, you must create a billing plan through this interface.

> After creating a plan, you need to complete the process of creating a site and binding the plan through [CreateZone](https://intl.cloud.tencent.com/document/product/1552/80719?from_cn_redirect=1), so that the EdgeOne can provide services properly.

error code that may be returned: 

FAILEDOPERATION_INSUFFICIENTACCOUNTBALANCE = "FailedOperation.InsufficientAccountBalance"
INVALIDPARAMETER_INVALIDAUTOUSEVOUCHER = "InvalidParameter.InvalidAutoUseVoucher"
INVALIDPARAMETER_INVALIDPERIOD = "InvalidParameter.InvalidPeriod"
INVALIDPARAMETER_INVALIDPLANTYPE = "InvalidParameter.InvalidPlanType"
INVALIDPARAMETER_INVALIDRENEWFLAG = "InvalidParameter.InvalidRenewFlag"
OPERATIONDENIED_PLEASECONTACTBUSINESSPERSONNEL = "OperationDenied.PleaseContactBusinessPersonnel"

func (*Client) CreatePrefetchTask 

func (c *Client) CreatePrefetchTask(request *CreatePrefetchTaskRequest) (response *CreatePrefetchTaskResponse, err error)

CreatePrefetchTask This API is used to create a pre-warming task.

error code that may be returned: 

INTERNALERROR_BACKENDERROR = "InternalError.BackendError"
INTERNALERROR_DOMAINCONFIG = "InternalError.DomainConfig"
INTERNALERROR_FAILEDTOGENERATEURL = "InternalError.FailedToGenerateUrl"
INTERNALERROR_QUOTASYSTEM = "InternalError.QuotaSystem"
INVALIDPARAMETER_DOMAINNOTFOUND = "InvalidParameter.DomainNotFound"
INVALIDPARAMETER_PARAMETERERROR = "InvalidParameter.ParameterError"
INVALIDPARAMETER_TARGET = "InvalidParameter.Target"
INVALIDPARAMETER_TASKNOTGENERATED = "InvalidParameter.TaskNotGenerated"
INVALIDPARAMETER_UPLOADURL = "InvalidParameter.UploadUrl"
LIMITEXCEEDED_BATCHQUOTA = "LimitExceeded.BatchQuota"
LIMITEXCEEDED_DAILYQUOTA = "LimitExceeded.DailyQuota"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) CreatePrefetchTaskWithContext 

func (c *Client) CreatePrefetchTaskWithContext(ctx context.Context, request *CreatePrefetchTaskRequest) (response *CreatePrefetchTaskResponse, err error)

CreatePrefetchTask This API is used to create a pre-warming task.

error code that may be returned: 

INTERNALERROR_BACKENDERROR = "InternalError.BackendError"
INTERNALERROR_DOMAINCONFIG = "InternalError.DomainConfig"
INTERNALERROR_FAILEDTOGENERATEURL = "InternalError.FailedToGenerateUrl"
INTERNALERROR_QUOTASYSTEM = "InternalError.QuotaSystem"
INVALIDPARAMETER_DOMAINNOTFOUND = "InvalidParameter.DomainNotFound"
INVALIDPARAMETER_PARAMETERERROR = "InvalidParameter.ParameterError"
INVALIDPARAMETER_TARGET = "InvalidParameter.Target"
INVALIDPARAMETER_TASKNOTGENERATED = "InvalidParameter.TaskNotGenerated"
INVALIDPARAMETER_UPLOADURL = "InvalidParameter.UploadUrl"
LIMITEXCEEDED_BATCHQUOTA = "LimitExceeded.BatchQuota"
LIMITEXCEEDED_DAILYQUOTA = "LimitExceeded.DailyQuota"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) CreatePurgeTask 

func (c *Client) CreatePurgeTask(request *CreatePurgeTaskRequest) (response *CreatePurgeTaskResponse, err error)

CreatePurgeTask When there are resources updated on the origin with the TTL remaining valid, users cannot access the latest resources. In this case, you can purge the cache using this API. There are two methods: <li>Delete: This method deletes the node cache without verification and retrieves the latest resources from the origin when receiving a request.</li><li>Invalidate: This method marks the node cache as invalid and sends a request with the If-None-Match and If-Modified-Since headers to the origin. If the origin responses with 200, the latest resources are retrieved to be cached on the node. If a 304 response is returned, the latest resources are not cached on the node.

</li>For more details, see [Cache Purge](https://intl.cloud.tencent.com/document/product/1552/70759?from_cn_redirect=1). </li>

error code that may be returned: 

INTERNALERROR_BACKENDERROR = "InternalError.BackendError"
INTERNALERROR_DOMAINCONFIG = "InternalError.DomainConfig"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_QUOTASYSTEM = "InternalError.QuotaSystem"
INVALIDPARAMETER_DOMAINNOTFOUND = "InvalidParameter.DomainNotFound"
INVALIDPARAMETER_PARAMETERERROR = "InvalidParameter.ParameterError"
INVALIDPARAMETER_TARGET = "InvalidParameter.Target"
INVALIDPARAMETER_TASKNOTGENERATED = "InvalidParameter.TaskNotGenerated"
INVALIDPARAMETER_UPLOADURL = "InvalidParameter.UploadUrl"
LIMITEXCEEDED_BATCHQUOTA = "LimitExceeded.BatchQuota"
LIMITEXCEEDED_DAILYQUOTA = "LimitExceeded.DailyQuota"
LIMITEXCEEDED_PACKNOTALLOW = "LimitExceeded.PackNotAllow"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) CreatePurgeTaskWithContext 

func (c *Client) CreatePurgeTaskWithContext(ctx context.Context, request *CreatePurgeTaskRequest) (response *CreatePurgeTaskResponse, err error)

CreatePurgeTask When there are resources updated on the origin with the TTL remaining valid, users cannot access the latest resources. In this case, you can purge the cache using this API. There are two methods: <li>Delete: This method deletes the node cache without verification and retrieves the latest resources from the origin when receiving a request.</li><li>Invalidate: This method marks the node cache as invalid and sends a request with the If-None-Match and If-Modified-Since headers to the origin. If the origin responses with 200, the latest resources are retrieved to be cached on the node. If a 304 response is returned, the latest resources are not cached on the node.

</li>For more details, see [Cache Purge](https://intl.cloud.tencent.com/document/product/1552/70759?from_cn_redirect=1). </li>

error code that may be returned: 

INTERNALERROR_BACKENDERROR = "InternalError.BackendError"
INTERNALERROR_DOMAINCONFIG = "InternalError.DomainConfig"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_QUOTASYSTEM = "InternalError.QuotaSystem"
INVALIDPARAMETER_DOMAINNOTFOUND = "InvalidParameter.DomainNotFound"
INVALIDPARAMETER_PARAMETERERROR = "InvalidParameter.ParameterError"
INVALIDPARAMETER_TARGET = "InvalidParameter.Target"
INVALIDPARAMETER_TASKNOTGENERATED = "InvalidParameter.TaskNotGenerated"
INVALIDPARAMETER_UPLOADURL = "InvalidParameter.UploadUrl"
LIMITEXCEEDED_BATCHQUOTA = "LimitExceeded.BatchQuota"
LIMITEXCEEDED_DAILYQUOTA = "LimitExceeded.DailyQuota"
LIMITEXCEEDED_PACKNOTALLOW = "LimitExceeded.PackNotAllow"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) CreateRealtimeLogDeliveryTask 

func (c *Client) CreateRealtimeLogDeliveryTask(request *CreateRealtimeLogDeliveryTaskRequest) (response *CreateRealtimeLogDeliveryTaskResponse, err error)

CreateRealtimeLogDeliveryTask This API is used to create a real-time log delivery task. The following limits apply:

An entity (a Layer 7 domain name or a Layer 4 proxy instance) under the combination of the same data delivery type (LogType) and data delivery area (Area) can be added to only one real-time log delivery task. It is recommended to first query the real-time log delivery task list by entity through the [DescribeRealtimeLogDeliveryTasks](https://intl.cloud.tencent.com/document/product/1552/104110?from_cn_redirect=1) API to check whether the entity has been added to another real-time log delivery task.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_CREATECLSLOGSETFAILED = "FailedOperation.CreateClsLogSetFailed"
FAILEDOPERATION_CREATECLSLOGTOPICTASKFAILED = "FailedOperation.CreateClsLogTopicTaskFailed"
FAILEDOPERATION_CREATELOGTOPICTASKAUTHFAILURE = "FailedOperation.CreateLogTopicTaskAuthFailure"
FAILEDOPERATION_REALTIMELOGAUTHFAILURE = "FailedOperation.RealtimeLogAuthFailure"
FAILEDOPERATION_REALTIMELOGNOTFOUND = "FailedOperation.RealtimeLogNotFound"
INVALIDPARAMETER = "InvalidParameter"
INVALIDPARAMETER_INVALIDLOGFORMATFIELDDELIMITER = "InvalidParameter.InvalidLogFormatFieldDelimiter"
INVALIDPARAMETER_INVALIDLOGFORMATFORMATTYPE = "InvalidParameter.InvalidLogFormatFormatType"
INVALIDPARAMETER_INVALIDLOGFORMATRECORDDELIMITER = "InvalidParameter.InvalidLogFormatRecordDelimiter"
INVALIDPARAMETER_REALTIMELOGENTITYALREADYCREATED = "InvalidParameter.RealtimeLogEntityAlreadyCreated"
INVALIDPARAMETER_REALTIMELOGINVALIDDELIVERYAREA = "InvalidParameter.RealtimeLogInvalidDeliveryArea"
INVALIDPARAMETER_REALTIMELOGINVALIDLOGTYPE = "InvalidParameter.RealtimeLogInvalidLogType"
INVALIDPARAMETER_REALTIMELOGINVALIDTASKTYPE = "InvalidParameter.RealtimeLogInvalidTaskType"
INVALIDPARAMETER_REALTIMELOGNUMSEXCEEDLIMIT = "InvalidParameter.RealtimeLogNumsExceedLimit"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
LIMITEXCEEDED = "LimitExceeded"
LIMITEXCEEDED_CUSTOMLOGFIELDREGEXLIMITEXCEEDED = "LimitExceeded.CustomLogFieldRegexLimitExceeded"
OPERATIONDENIED = "OperationDenied"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"

func (*Client) CreateRealtimeLogDeliveryTaskWithContext 

func (c *Client) CreateRealtimeLogDeliveryTaskWithContext(ctx context.Context, request *CreateRealtimeLogDeliveryTaskRequest) (response *CreateRealtimeLogDeliveryTaskResponse, err error)

CreateRealtimeLogDeliveryTask This API is used to create a real-time log delivery task. The following limits apply:

An entity (a Layer 7 domain name or a Layer 4 proxy instance) under the combination of the same data delivery type (LogType) and data delivery area (Area) can be added to only one real-time log delivery task. It is recommended to first query the real-time log delivery task list by entity through the [DescribeRealtimeLogDeliveryTasks](https://intl.cloud.tencent.com/document/product/1552/104110?from_cn_redirect=1) API to check whether the entity has been added to another real-time log delivery task.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_CREATECLSLOGSETFAILED = "FailedOperation.CreateClsLogSetFailed"
FAILEDOPERATION_CREATECLSLOGTOPICTASKFAILED = "FailedOperation.CreateClsLogTopicTaskFailed"
FAILEDOPERATION_CREATELOGTOPICTASKAUTHFAILURE = "FailedOperation.CreateLogTopicTaskAuthFailure"
FAILEDOPERATION_REALTIMELOGAUTHFAILURE = "FailedOperation.RealtimeLogAuthFailure"
FAILEDOPERATION_REALTIMELOGNOTFOUND = "FailedOperation.RealtimeLogNotFound"
INVALIDPARAMETER = "InvalidParameter"
INVALIDPARAMETER_INVALIDLOGFORMATFIELDDELIMITER = "InvalidParameter.InvalidLogFormatFieldDelimiter"
INVALIDPARAMETER_INVALIDLOGFORMATFORMATTYPE = "InvalidParameter.InvalidLogFormatFormatType"
INVALIDPARAMETER_INVALIDLOGFORMATRECORDDELIMITER = "InvalidParameter.InvalidLogFormatRecordDelimiter"
INVALIDPARAMETER_REALTIMELOGENTITYALREADYCREATED = "InvalidParameter.RealtimeLogEntityAlreadyCreated"
INVALIDPARAMETER_REALTIMELOGINVALIDDELIVERYAREA = "InvalidParameter.RealtimeLogInvalidDeliveryArea"
INVALIDPARAMETER_REALTIMELOGINVALIDLOGTYPE = "InvalidParameter.RealtimeLogInvalidLogType"
INVALIDPARAMETER_REALTIMELOGINVALIDTASKTYPE = "InvalidParameter.RealtimeLogInvalidTaskType"
INVALIDPARAMETER_REALTIMELOGNUMSEXCEEDLIMIT = "InvalidParameter.RealtimeLogNumsExceedLimit"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
LIMITEXCEEDED = "LimitExceeded"
LIMITEXCEEDED_CUSTOMLOGFIELDREGEXLIMITEXCEEDED = "LimitExceeded.CustomLogFieldRegexLimitExceeded"
OPERATIONDENIED = "OperationDenied"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"

func (*Client) CreateRule 

func (c *Client) CreateRule(request *CreateRuleRequest) (response *CreateRuleResponse, err error)

CreateRule This API is used to create a rule in the rule engine.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_ACCESSREDIRECTREGEXERROR = "InvalidParameter.AccessRedirectRegexError"
INVALIDPARAMETER_ACTIONINPROGRESS = "InvalidParameter.ActionInProgress"
INVALIDPARAMETER_CERTSYSTEMERROR = "InvalidParameter.CertSystemError"
INVALIDPARAMETER_ERRACTIONUNSUPPORTTARGET = "InvalidParameter.ErrActionUnsupportTarget"
INVALIDPARAMETER_ERRINVALIDACTION = "InvalidParameter.ErrInvalidAction"
INVALIDPARAMETER_ERRINVALIDACTIONORIGINPRIVATEADDRESS = "InvalidParameter.ErrInvalidActionOriginPrivateAddress"
INVALIDPARAMETER_ERRINVALIDACTIONPARAM = "InvalidParameter.ErrInvalidActionParam"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMACTION = "InvalidParameter.ErrInvalidActionParamAction"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMBADVALUETYPE = "InvalidParameter.ErrInvalidActionParamBadValueType"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMDUPLICATENAME = "InvalidParameter.ErrInvalidActionParamDuplicateName"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMNAME = "InvalidParameter.ErrInvalidActionParamName"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMVALUE = "InvalidParameter.ErrInvalidActionParamValue"
INVALIDPARAMETER_ERRINVALIDACTIONTYPE = "InvalidParameter.ErrInvalidActionType"
INVALIDPARAMETER_ERRINVALIDCONDITION = "InvalidParameter.ErrInvalidCondition"
INVALIDPARAMETER_ERRINVALIDCONDITIONCANNOTONLYCONTAINHOSTWHENMODIFYORIGINACTIONCONFIGURED = "InvalidParameter.ErrInvalidConditionCannotOnlyContainHostWhenModifyOriginActionConfigured"
INVALIDPARAMETER_ERRINVALIDCONDITIONIGNORECASE = "InvalidParameter.ErrInvalidConditionIgnoreCase"
INVALIDPARAMETER_ERRINVALIDCONDITIONNAMEBADNAME = "InvalidParameter.ErrInvalidConditionNameBadName"
INVALIDPARAMETER_ERRINVALIDCONDITIONNAMETARGETNOTSUPPORTNAME = "InvalidParameter.ErrInvalidConditionNameTargetNotSupportName"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADREGULAR = "InvalidParameter.ErrInvalidConditionValueBadRegular"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADURL = "InvalidParameter.ErrInvalidConditionValueBadUrl"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADVALUE = "InvalidParameter.ErrInvalidConditionValueBadValue"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADVALUECONTAINFILENAMEEXTENSION = "InvalidParameter.ErrInvalidConditionValueBadValueContainFileNameExtension"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUETOOLONGVALUE = "InvalidParameter.ErrInvalidConditionValueTooLongValue"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUETOOMANYREGULAR = "InvalidParameter.ErrInvalidConditionValueTooManyRegular"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUETOOMANYVALUES = "InvalidParameter.ErrInvalidConditionValueTooManyValues"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUETOOMANYWILDCARD = "InvalidParameter.ErrInvalidConditionValueTooManyWildcard"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEZEROLENGTH = "InvalidParameter.ErrInvalidConditionValueZeroLength"
INVALIDPARAMETER_ERRNILCONDITION = "InvalidParameter.ErrNilCondition"
INVALIDPARAMETER_GRPCREQUIREHTTP2 = "InvalidParameter.GrpcRequireHttp2"
INVALIDPARAMETER_HOSTNOTFOUND = "InvalidParameter.HostNotFound"
INVALIDPARAMETER_INVALIDAUTHENTICATION = "InvalidParameter.InvalidAuthentication"
INVALIDPARAMETER_INVALIDAUTHENTICATIONTYPEEXPIRETIME = "InvalidParameter.InvalidAuthenticationTypeExpireTime"
INVALIDPARAMETER_INVALIDAUTHENTICATIONTYPESIGNPARAM = "InvalidParameter.InvalidAuthenticationTypeSignParam"
INVALIDPARAMETER_INVALIDAWSREGION = "InvalidParameter.InvalidAwsRegion"
INVALIDPARAMETER_INVALIDBACKUPSERVERNAME = "InvalidParameter.InvalidBackupServerName"
INVALIDPARAMETER_INVALIDCACHECONFIGCACHE = "InvalidParameter.InvalidCacheConfigCache"
INVALIDPARAMETER_INVALIDCACHEKEY = "InvalidParameter.InvalidCacheKey"
INVALIDPARAMETER_INVALIDCACHEKEYQUERYSTRINGVALUE = "InvalidParameter.InvalidCacheKeyQueryStringValue"
INVALIDPARAMETER_INVALIDCACHETIME = "InvalidParameter.InvalidCacheTime"
INVALIDPARAMETER_INVALIDCLIENTIPHEADERNAME = "InvalidParameter.InvalidClientIpHeaderName"
INVALIDPARAMETER_INVALIDDYNAMICROUTINE = "InvalidParameter.InvalidDynamicRoutine"
INVALIDPARAMETER_INVALIDDYNAMICROUTINEBILLING = "InvalidParameter.InvalidDynamicRoutineBilling"
INVALIDPARAMETER_INVALIDERRORPAGEREDIRECTURL = "InvalidParameter.InvalidErrorPageRedirectUrl"
INVALIDPARAMETER_INVALIDHTTPSCIPHERSUITEANDTLSVERSION = "InvalidParameter.InvalidHttpsCipherSuiteAndTlsVersion"
INVALIDPARAMETER_INVALIDHTTPSHSTSMAXAGE = "InvalidParameter.InvalidHttpsHstsMaxAge"
INVALIDPARAMETER_INVALIDIPV6SWITCH = "InvalidParameter.InvalidIpv6Switch"
INVALIDPARAMETER_INVALIDMAXAGETIME = "InvalidParameter.InvalidMaxAgeTime"
INVALIDPARAMETER_INVALIDORIGIN = "InvalidParameter.InvalidOrigin"
INVALIDPARAMETER_INVALIDPARAMETER = "InvalidParameter.InvalidParameter"
INVALIDPARAMETER_INVALIDPOSTSIZEVALUE = "InvalidParameter.InvalidPostSizeValue"
INVALIDPARAMETER_INVALIDRANGEORIGINPULL = "InvalidParameter.InvalidRangeOriginPull"
INVALIDPARAMETER_INVALIDREQUESTHEADERNAME = "InvalidParameter.InvalidRequestHeaderName"
INVALIDPARAMETER_INVALIDREQUESTHEADERNAMEXFF = "InvalidParameter.InvalidRequestHeaderNameXff"
INVALIDPARAMETER_INVALIDREQUESTHEADERVALUE = "InvalidParameter.InvalidRequestHeaderValue"
INVALIDPARAMETER_INVALIDRESPONSEHEADERNAME = "InvalidParameter.InvalidResponseHeaderName"
INVALIDPARAMETER_INVALIDRESPONSEHEADERVALUE = "InvalidParameter.InvalidResponseHeaderValue"
INVALIDPARAMETER_INVALIDRULEENGINEACTION = "InvalidParameter.InvalidRuleEngineAction"
INVALIDPARAMETER_INVALIDRULEENGINETARGET = "InvalidParameter.InvalidRuleEngineTarget"
INVALIDPARAMETER_INVALIDRULEENGINETARGETSEXTENSION = "InvalidParameter.InvalidRuleEngineTargetsExtension"
INVALIDPARAMETER_INVALIDRULEENGINETARGETSURL = "InvalidParameter.InvalidRuleEngineTargetsUrl"
INVALIDPARAMETER_INVALIDSERVERNAME = "InvalidParameter.InvalidServerName"
INVALIDPARAMETER_INVALIDSTANDARDDEBUGEXPIRETIMELIMIT = "InvalidParameter.InvalidStandardDebugExpireTimeLimit"
INVALIDPARAMETER_INVALIDUPSTREAMREQUESTQUERYSTRINGVALUE = "InvalidParameter.InvalidUpstreamRequestQueryStringValue"
INVALIDPARAMETER_INVALIDURLREDIRECT = "InvalidParameter.InvalidUrlRedirect"
INVALIDPARAMETER_INVALIDURLREDIRECTHOST = "InvalidParameter.InvalidUrlRedirectHost"
INVALIDPARAMETER_INVALIDURLREDIRECTURL = "InvalidParameter.InvalidUrlRedirectUrl"
INVALIDPARAMETER_INVALIDWEBSOCKETTIMEOUT = "InvalidParameter.InvalidWebSocketTimeout"
INVALIDPARAMETER_KEYRULESINVALIDQUERYSTRINGVALUE = "InvalidParameter.KeyRulesInvalidQueryStringValue"
INVALIDPARAMETER_LOADBALANCEINSTANCEIDISREQUIRED = "InvalidParameter.LoadBalanceInstanceIdIsRequired"
INVALIDPARAMETER_NOTSUPPORTTHISPRESET = "InvalidParameter.NotSupportThisPreset"
INVALIDPARAMETER_ORIGINORIGINGROUPIDISREQUIRED = "InvalidParameter.OriginOriginGroupIdIsRequired"
INVALIDPARAMETER_POSTMAXSIZELIMITEXCEEDED = "InvalidParameter.PostMaxSizeLimitExceeded"
INVALIDPARAMETER_TASKSYSTEMERROR = "InvalidParameter.TaskSystemError"
INVALIDPARAMETERVALUE_FORMATMISMATCH = "InvalidParameterValue.FormatMismatch"
INVALIDPARAMETERVALUE_GENERALMISMATCH = "InvalidParameterValue.GeneralMismatch"
INVALIDPARAMETERVALUE_INCLUDEINVALIDVALUE = "InvalidParameterValue.IncludeInvalidValue"
INVALIDPARAMETERVALUE_MISSINGNECESSARYPARAM = "InvalidParameterValue.MissingNecessaryParam"
INVALIDPARAMETERVALUE_NOTINENUMERATION = "InvalidParameterValue.NotInEnumeration"
INVALIDPARAMETERVALUE_NOTWITHINRANGE = "InvalidParameterValue.NotWithinRange"
INVALIDPARAMETERVALUE_REGEXMISMATCH = "InvalidParameterValue.RegExMismatch"
INVALIDPARAMETERVALUE_UNRECOGNIZABLEVALUE = "InvalidParameterValue.UnrecognizableValue"
LIMITEXCEEDED = "LimitExceeded"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ACCELERATEMAINLANDMULTIPLYLAYERCONFLICT = "OperationDenied.AccelerateMainlandMultiplyLayerConflict"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_INVALIDADVANCEDDEFENSESECURITYTYPE = "OperationDenied.InvalidAdvancedDefenseSecurityType"
RESOURCEINUSE = "ResourceInUse"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) CreateRuleWithContext 

func (c *Client) CreateRuleWithContext(ctx context.Context, request *CreateRuleRequest) (response *CreateRuleResponse, err error)

CreateRule This API is used to create a rule in the rule engine.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_ACCESSREDIRECTREGEXERROR = "InvalidParameter.AccessRedirectRegexError"
INVALIDPARAMETER_ACTIONINPROGRESS = "InvalidParameter.ActionInProgress"
INVALIDPARAMETER_CERTSYSTEMERROR = "InvalidParameter.CertSystemError"
INVALIDPARAMETER_ERRACTIONUNSUPPORTTARGET = "InvalidParameter.ErrActionUnsupportTarget"
INVALIDPARAMETER_ERRINVALIDACTION = "InvalidParameter.ErrInvalidAction"
INVALIDPARAMETER_ERRINVALIDACTIONORIGINPRIVATEADDRESS = "InvalidParameter.ErrInvalidActionOriginPrivateAddress"
INVALIDPARAMETER_ERRINVALIDACTIONPARAM = "InvalidParameter.ErrInvalidActionParam"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMACTION = "InvalidParameter.ErrInvalidActionParamAction"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMBADVALUETYPE = "InvalidParameter.ErrInvalidActionParamBadValueType"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMDUPLICATENAME = "InvalidParameter.ErrInvalidActionParamDuplicateName"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMNAME = "InvalidParameter.ErrInvalidActionParamName"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMVALUE = "InvalidParameter.ErrInvalidActionParamValue"
INVALIDPARAMETER_ERRINVALIDACTIONTYPE = "InvalidParameter.ErrInvalidActionType"
INVALIDPARAMETER_ERRINVALIDCONDITION = "InvalidParameter.ErrInvalidCondition"
INVALIDPARAMETER_ERRINVALIDCONDITIONCANNOTONLYCONTAINHOSTWHENMODIFYORIGINACTIONCONFIGURED = "InvalidParameter.ErrInvalidConditionCannotOnlyContainHostWhenModifyOriginActionConfigured"
INVALIDPARAMETER_ERRINVALIDCONDITIONIGNORECASE = "InvalidParameter.ErrInvalidConditionIgnoreCase"
INVALIDPARAMETER_ERRINVALIDCONDITIONNAMEBADNAME = "InvalidParameter.ErrInvalidConditionNameBadName"
INVALIDPARAMETER_ERRINVALIDCONDITIONNAMETARGETNOTSUPPORTNAME = "InvalidParameter.ErrInvalidConditionNameTargetNotSupportName"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADREGULAR = "InvalidParameter.ErrInvalidConditionValueBadRegular"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADURL = "InvalidParameter.ErrInvalidConditionValueBadUrl"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADVALUE = "InvalidParameter.ErrInvalidConditionValueBadValue"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADVALUECONTAINFILENAMEEXTENSION = "InvalidParameter.ErrInvalidConditionValueBadValueContainFileNameExtension"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUETOOLONGVALUE = "InvalidParameter.ErrInvalidConditionValueTooLongValue"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUETOOMANYREGULAR = "InvalidParameter.ErrInvalidConditionValueTooManyRegular"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUETOOMANYVALUES = "InvalidParameter.ErrInvalidConditionValueTooManyValues"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUETOOMANYWILDCARD = "InvalidParameter.ErrInvalidConditionValueTooManyWildcard"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEZEROLENGTH = "InvalidParameter.ErrInvalidConditionValueZeroLength"
INVALIDPARAMETER_ERRNILCONDITION = "InvalidParameter.ErrNilCondition"
INVALIDPARAMETER_GRPCREQUIREHTTP2 = "InvalidParameter.GrpcRequireHttp2"
INVALIDPARAMETER_HOSTNOTFOUND = "InvalidParameter.HostNotFound"
INVALIDPARAMETER_INVALIDAUTHENTICATION = "InvalidParameter.InvalidAuthentication"
INVALIDPARAMETER_INVALIDAUTHENTICATIONTYPEEXPIRETIME = "InvalidParameter.InvalidAuthenticationTypeExpireTime"
INVALIDPARAMETER_INVALIDAUTHENTICATIONTYPESIGNPARAM = "InvalidParameter.InvalidAuthenticationTypeSignParam"
INVALIDPARAMETER_INVALIDAWSREGION = "InvalidParameter.InvalidAwsRegion"
INVALIDPARAMETER_INVALIDBACKUPSERVERNAME = "InvalidParameter.InvalidBackupServerName"
INVALIDPARAMETER_INVALIDCACHECONFIGCACHE = "InvalidParameter.InvalidCacheConfigCache"
INVALIDPARAMETER_INVALIDCACHEKEY = "InvalidParameter.InvalidCacheKey"
INVALIDPARAMETER_INVALIDCACHEKEYQUERYSTRINGVALUE = "InvalidParameter.InvalidCacheKeyQueryStringValue"
INVALIDPARAMETER_INVALIDCACHETIME = "InvalidParameter.InvalidCacheTime"
INVALIDPARAMETER_INVALIDCLIENTIPHEADERNAME = "InvalidParameter.InvalidClientIpHeaderName"
INVALIDPARAMETER_INVALIDDYNAMICROUTINE = "InvalidParameter.InvalidDynamicRoutine"
INVALIDPARAMETER_INVALIDDYNAMICROUTINEBILLING = "InvalidParameter.InvalidDynamicRoutineBilling"
INVALIDPARAMETER_INVALIDERRORPAGEREDIRECTURL = "InvalidParameter.InvalidErrorPageRedirectUrl"
INVALIDPARAMETER_INVALIDHTTPSCIPHERSUITEANDTLSVERSION = "InvalidParameter.InvalidHttpsCipherSuiteAndTlsVersion"
INVALIDPARAMETER_INVALIDHTTPSHSTSMAXAGE = "InvalidParameter.InvalidHttpsHstsMaxAge"
INVALIDPARAMETER_INVALIDIPV6SWITCH = "InvalidParameter.InvalidIpv6Switch"
INVALIDPARAMETER_INVALIDMAXAGETIME = "InvalidParameter.InvalidMaxAgeTime"
INVALIDPARAMETER_INVALIDORIGIN = "InvalidParameter.InvalidOrigin"
INVALIDPARAMETER_INVALIDPARAMETER = "InvalidParameter.InvalidParameter"
INVALIDPARAMETER_INVALIDPOSTSIZEVALUE = "InvalidParameter.InvalidPostSizeValue"
INVALIDPARAMETER_INVALIDRANGEORIGINPULL = "InvalidParameter.InvalidRangeOriginPull"
INVALIDPARAMETER_INVALIDREQUESTHEADERNAME = "InvalidParameter.InvalidRequestHeaderName"
INVALIDPARAMETER_INVALIDREQUESTHEADERNAMEXFF = "InvalidParameter.InvalidRequestHeaderNameXff"
INVALIDPARAMETER_INVALIDREQUESTHEADERVALUE = "InvalidParameter.InvalidRequestHeaderValue"
INVALIDPARAMETER_INVALIDRESPONSEHEADERNAME = "InvalidParameter.InvalidResponseHeaderName"
INVALIDPARAMETER_INVALIDRESPONSEHEADERVALUE = "InvalidParameter.InvalidResponseHeaderValue"
INVALIDPARAMETER_INVALIDRULEENGINEACTION = "InvalidParameter.InvalidRuleEngineAction"
INVALIDPARAMETER_INVALIDRULEENGINETARGET = "InvalidParameter.InvalidRuleEngineTarget"
INVALIDPARAMETER_INVALIDRULEENGINETARGETSEXTENSION = "InvalidParameter.InvalidRuleEngineTargetsExtension"
INVALIDPARAMETER_INVALIDRULEENGINETARGETSURL = "InvalidParameter.InvalidRuleEngineTargetsUrl"
INVALIDPARAMETER_INVALIDSERVERNAME = "InvalidParameter.InvalidServerName"
INVALIDPARAMETER_INVALIDSTANDARDDEBUGEXPIRETIMELIMIT = "InvalidParameter.InvalidStandardDebugExpireTimeLimit"
INVALIDPARAMETER_INVALIDUPSTREAMREQUESTQUERYSTRINGVALUE = "InvalidParameter.InvalidUpstreamRequestQueryStringValue"
INVALIDPARAMETER_INVALIDURLREDIRECT = "InvalidParameter.InvalidUrlRedirect"
INVALIDPARAMETER_INVALIDURLREDIRECTHOST = "InvalidParameter.InvalidUrlRedirectHost"
INVALIDPARAMETER_INVALIDURLREDIRECTURL = "InvalidParameter.InvalidUrlRedirectUrl"
INVALIDPARAMETER_INVALIDWEBSOCKETTIMEOUT = "InvalidParameter.InvalidWebSocketTimeout"
INVALIDPARAMETER_KEYRULESINVALIDQUERYSTRINGVALUE = "InvalidParameter.KeyRulesInvalidQueryStringValue"
INVALIDPARAMETER_LOADBALANCEINSTANCEIDISREQUIRED = "InvalidParameter.LoadBalanceInstanceIdIsRequired"
INVALIDPARAMETER_NOTSUPPORTTHISPRESET = "InvalidParameter.NotSupportThisPreset"
INVALIDPARAMETER_ORIGINORIGINGROUPIDISREQUIRED = "InvalidParameter.OriginOriginGroupIdIsRequired"
INVALIDPARAMETER_POSTMAXSIZELIMITEXCEEDED = "InvalidParameter.PostMaxSizeLimitExceeded"
INVALIDPARAMETER_TASKSYSTEMERROR = "InvalidParameter.TaskSystemError"
INVALIDPARAMETERVALUE_FORMATMISMATCH = "InvalidParameterValue.FormatMismatch"
INVALIDPARAMETERVALUE_GENERALMISMATCH = "InvalidParameterValue.GeneralMismatch"
INVALIDPARAMETERVALUE_INCLUDEINVALIDVALUE = "InvalidParameterValue.IncludeInvalidValue"
INVALIDPARAMETERVALUE_MISSINGNECESSARYPARAM = "InvalidParameterValue.MissingNecessaryParam"
INVALIDPARAMETERVALUE_NOTINENUMERATION = "InvalidParameterValue.NotInEnumeration"
INVALIDPARAMETERVALUE_NOTWITHINRANGE = "InvalidParameterValue.NotWithinRange"
INVALIDPARAMETERVALUE_REGEXMISMATCH = "InvalidParameterValue.RegExMismatch"
INVALIDPARAMETERVALUE_UNRECOGNIZABLEVALUE = "InvalidParameterValue.UnrecognizableValue"
LIMITEXCEEDED = "LimitExceeded"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ACCELERATEMAINLANDMULTIPLYLAYERCONFLICT = "OperationDenied.AccelerateMainlandMultiplyLayerConflict"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_INVALIDADVANCEDDEFENSESECURITYTYPE = "OperationDenied.InvalidAdvancedDefenseSecurityType"
RESOURCEINUSE = "ResourceInUse"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) CreateSecurityIPGroup 

func (c *Client) CreateSecurityIPGroup(request *CreateSecurityIPGroupRequest) (response *CreateSecurityIPGroupResponse, err error)

CreateSecurityIPGroup This API is used to create a security IP group.

error code that may be returned: 

INVALIDPARAMETER_SECURITY = "InvalidParameter.Security"
OPERATIONDENIED = "OperationDenied"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) CreateSecurityIPGroupWithContext 

func (c *Client) CreateSecurityIPGroupWithContext(ctx context.Context, request *CreateSecurityIPGroupRequest) (response *CreateSecurityIPGroupResponse, err error)

CreateSecurityIPGroup This API is used to create a security IP group.

error code that may be returned: 

INVALIDPARAMETER_SECURITY = "InvalidParameter.Security"
OPERATIONDENIED = "OperationDenied"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) CreateSharedCNAME 

func (c *Client) CreateSharedCNAME(request *CreateSharedCNAMERequest) (response *CreateSharedCNAMEResponse, err error)

CreateSharedCNAME This API is used to create a shared CNAME. It is now only available to beta users.

error code that may be returned: 

INVALIDPARAMETERVALUE_NOTALLOWEDWILDCARDSHAREDCNAME = "InvalidParameterValue.NotAllowedWildcardSharedCNAME"
INVALIDPARAMETERVALUE_SHAREDCNAMEPREFIXNOTMATCH = "InvalidParameterValue.SharedCNAMEPrefixNotMatch"
LIMITEXCEEDED = "LimitExceeded"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
RESOURCEUNAVAILABLE_SHAREDCNAMEALREADYEXISTS = "ResourceUnavailable.SharedCNAMEAlreadyExists"

func (*Client) CreateSharedCNAMEWithContext 

func (c *Client) CreateSharedCNAMEWithContext(ctx context.Context, request *CreateSharedCNAMERequest) (response *CreateSharedCNAMEResponse, err error)

CreateSharedCNAME This API is used to create a shared CNAME. It is now only available to beta users.

error code that may be returned: 

INVALIDPARAMETERVALUE_NOTALLOWEDWILDCARDSHAREDCNAME = "InvalidParameterValue.NotAllowedWildcardSharedCNAME"
INVALIDPARAMETERVALUE_SHAREDCNAMEPREFIXNOTMATCH = "InvalidParameterValue.SharedCNAMEPrefixNotMatch"
LIMITEXCEEDED = "LimitExceeded"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
RESOURCEUNAVAILABLE_SHAREDCNAMEALREADYEXISTS = "ResourceUnavailable.SharedCNAMEAlreadyExists"

func (*Client) CreateZone 

func (c *Client) CreateZone(request *CreateZoneRequest) (response *CreateZoneResponse, err error)

CreateZone This API is used to create a site. After you create the site, you can connect it to EdgeOne via the CNAME or NS (see [Quick Start](https://intl.cloud.tencent.com/document/product/1552/87601?from_cn_redirect=1)), or connect it without a domain name (see [Quick Access to L4 Proxy Service](https://intl.cloud.tencent.com/document/product/1552/96051?from_cn_redirect=1)).

If there are already EdgeOne plans under the current account, it is recommended to pass in the `PlanId` to bind the site with the plan directly. If `PlanId` is not passed in, the created site is not activated. You need to call [BindZoneToPlan](https://intl.cloud.tencent.com/document/product/1552/83042?from_cn_redirect=1) to bind the site with a plan. To purchase a plan, please go to the EdgeOne console.

error code that may be returned: 

DRYRUNOPERATION = "DryRunOperation"
INTERNALERROR_FAILEDTOCALLDNSPOD = "InternalError.FailedToCallDNSPod"
INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_LENGTHEXCEEDSLIMIT = "InvalidParameter.LengthExceedsLimit"
INVALIDPARAMETER_PLANNOTFOUND = "InvalidParameter.PlanNotFound"
INVALIDPARAMETER_ZONEHASBEENBOUND = "InvalidParameter.ZoneHasBeenBound"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
INVALIDPARAMETERVALUE_ACCESSBLACKLIST = "InvalidParameterValue.AccessBlacklist"
INVALIDPARAMETERVALUE_INVALIDTAGVALUE = "InvalidParameterValue.InvalidTagValue"
INVALIDPARAMETERVALUE_TOPLEVELDOMAINNOTSUPPORT = "InvalidParameterValue.TopLevelDomainNotSupport"
INVALIDPARAMETERVALUE_ZONENAMEINVALID = "InvalidParameterValue.ZoneNameInvalid"
INVALIDPARAMETERVALUE_ZONENAMENOTSUPPORTPUNYCODE = "InvalidParameterValue.ZoneNameNotSupportPunyCode"
INVALIDPARAMETERVALUE_ZONENAMENOTSUPPORTSUBDOMAIN = "InvalidParameterValue.ZoneNameNotSupportSubDomain"
INVALIDPARAMETERVALUE_ZONESAMEASNAME = "InvalidParameterValue.ZoneSameAsName"
LIMITEXCEEDED_ZONEBINDPLAN = "LimitExceeded.ZoneBindPlan"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_COMPLIANCEFORBIDDEN = "OperationDenied.ComplianceForbidden"
OPERATIONDENIED_DNSPODUNAUTHORIZEDROLEOPERATION = "OperationDenied.DNSPodUnauthorizedRoleOperation"
OPERATIONDENIED_DOMAINISBLOCKED = "OperationDenied.DomainIsBlocked"
OPERATIONDENIED_RECORDISFORBIDDEN = "OperationDenied.RecordIsForbidden"
RESOURCEINUSE = "ResourceInUse"
RESOURCEINUSE_ALIASDOMAIN = "ResourceInUse.AliasDomain"
RESOURCEINUSE_CNAME = "ResourceInUse.Cname"
RESOURCEINUSE_DNS = "ResourceInUse.Dns"
RESOURCEINUSE_GENERICHOST = "ResourceInUse.GenericHost"
RESOURCEINUSE_HOST = "ResourceInUse.Host"
RESOURCEINUSE_NS = "ResourceInUse.NS"
RESOURCEINUSE_OTHERS = "ResourceInUse.Others"
RESOURCEINUSE_OTHERSALIASDOMAIN = "ResourceInUse.OthersAliasDomain"
RESOURCEINUSE_OTHERSCNAME = "ResourceInUse.OthersCname"
RESOURCEINUSE_OTHERSHOST = "ResourceInUse.OthersHost"
RESOURCEINUSE_OTHERSNS = "ResourceInUse.OthersNS"
RESOURCEINUSE_SELFANDOTHERSCNAME = "ResourceInUse.SelfAndOthersCname"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCENOTFOUND_DNSPODDOMAINNOTINACCOUNT = "ResourceNotFound.DNSPodDomainNotInAccount"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) CreateZoneWithContext 

func (c *Client) CreateZoneWithContext(ctx context.Context, request *CreateZoneRequest) (response *CreateZoneResponse, err error)

CreateZone This API is used to create a site. After you create the site, you can connect it to EdgeOne via the CNAME or NS (see [Quick Start](https://intl.cloud.tencent.com/document/product/1552/87601?from_cn_redirect=1)), or connect it without a domain name (see [Quick Access to L4 Proxy Service](https://intl.cloud.tencent.com/document/product/1552/96051?from_cn_redirect=1)).

If there are already EdgeOne plans under the current account, it is recommended to pass in the `PlanId` to bind the site with the plan directly. If `PlanId` is not passed in, the created site is not activated. You need to call [BindZoneToPlan](https://intl.cloud.tencent.com/document/product/1552/83042?from_cn_redirect=1) to bind the site with a plan. To purchase a plan, please go to the EdgeOne console.

error code that may be returned: 

DRYRUNOPERATION = "DryRunOperation"
INTERNALERROR_FAILEDTOCALLDNSPOD = "InternalError.FailedToCallDNSPod"
INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_LENGTHEXCEEDSLIMIT = "InvalidParameter.LengthExceedsLimit"
INVALIDPARAMETER_PLANNOTFOUND = "InvalidParameter.PlanNotFound"
INVALIDPARAMETER_ZONEHASBEENBOUND = "InvalidParameter.ZoneHasBeenBound"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
INVALIDPARAMETERVALUE_ACCESSBLACKLIST = "InvalidParameterValue.AccessBlacklist"
INVALIDPARAMETERVALUE_INVALIDTAGVALUE = "InvalidParameterValue.InvalidTagValue"
INVALIDPARAMETERVALUE_TOPLEVELDOMAINNOTSUPPORT = "InvalidParameterValue.TopLevelDomainNotSupport"
INVALIDPARAMETERVALUE_ZONENAMEINVALID = "InvalidParameterValue.ZoneNameInvalid"
INVALIDPARAMETERVALUE_ZONENAMENOTSUPPORTPUNYCODE = "InvalidParameterValue.ZoneNameNotSupportPunyCode"
INVALIDPARAMETERVALUE_ZONENAMENOTSUPPORTSUBDOMAIN = "InvalidParameterValue.ZoneNameNotSupportSubDomain"
INVALIDPARAMETERVALUE_ZONESAMEASNAME = "InvalidParameterValue.ZoneSameAsName"
LIMITEXCEEDED_ZONEBINDPLAN = "LimitExceeded.ZoneBindPlan"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_COMPLIANCEFORBIDDEN = "OperationDenied.ComplianceForbidden"
OPERATIONDENIED_DNSPODUNAUTHORIZEDROLEOPERATION = "OperationDenied.DNSPodUnauthorizedRoleOperation"
OPERATIONDENIED_DOMAINISBLOCKED = "OperationDenied.DomainIsBlocked"
OPERATIONDENIED_RECORDISFORBIDDEN = "OperationDenied.RecordIsForbidden"
RESOURCEINUSE = "ResourceInUse"
RESOURCEINUSE_ALIASDOMAIN = "ResourceInUse.AliasDomain"
RESOURCEINUSE_CNAME = "ResourceInUse.Cname"
RESOURCEINUSE_DNS = "ResourceInUse.Dns"
RESOURCEINUSE_GENERICHOST = "ResourceInUse.GenericHost"
RESOURCEINUSE_HOST = "ResourceInUse.Host"
RESOURCEINUSE_NS = "ResourceInUse.NS"
RESOURCEINUSE_OTHERS = "ResourceInUse.Others"
RESOURCEINUSE_OTHERSALIASDOMAIN = "ResourceInUse.OthersAliasDomain"
RESOURCEINUSE_OTHERSCNAME = "ResourceInUse.OthersCname"
RESOURCEINUSE_OTHERSHOST = "ResourceInUse.OthersHost"
RESOURCEINUSE_OTHERSNS = "ResourceInUse.OthersNS"
RESOURCEINUSE_SELFANDOTHERSCNAME = "ResourceInUse.SelfAndOthersCname"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCENOTFOUND_DNSPODDOMAINNOTINACCOUNT = "ResourceNotFound.DNSPodDomainNotInAccount"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DeleteAccelerationDomains 

func (c *Client) DeleteAccelerationDomains(request *DeleteAccelerationDomainsRequest) (response *DeleteAccelerationDomainsResponse, err error)

DeleteAccelerationDomains This API is used to batch remove accelerated domain names.

error code that may be returned: 

INVALIDPARAMETER_ZONEISGRAYPUBLISHING = "InvalidParameter.ZoneIsGrayPublishing"
INVALIDPARAMETER_ZONENOTFOUND = "InvalidParameter.ZoneNotFound"
INVALIDPARAMETERVALUE_INVALIDDOMAINSTATUS = "InvalidParameterValue.InvalidDomainStatus"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_RESOURCELOCKEDTEMPORARY = "OperationDenied.ResourceLockedTemporary"
OPERATIONDENIED_VERSIONCONTROLISGRAYING = "OperationDenied.VersionControlIsGraying"
RESOURCEINUSE = "ResourceInUse"
RESOURCEUNAVAILABLE_DOMAINNOTFOUND = "ResourceUnavailable.DomainNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DeleteAccelerationDomainsWithContext 

func (c *Client) DeleteAccelerationDomainsWithContext(ctx context.Context, request *DeleteAccelerationDomainsRequest) (response *DeleteAccelerationDomainsResponse, err error)

DeleteAccelerationDomains This API is used to batch remove accelerated domain names.

error code that may be returned: 

INVALIDPARAMETER_ZONEISGRAYPUBLISHING = "InvalidParameter.ZoneIsGrayPublishing"
INVALIDPARAMETER_ZONENOTFOUND = "InvalidParameter.ZoneNotFound"
INVALIDPARAMETERVALUE_INVALIDDOMAINSTATUS = "InvalidParameterValue.InvalidDomainStatus"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_RESOURCELOCKEDTEMPORARY = "OperationDenied.ResourceLockedTemporary"
OPERATIONDENIED_VERSIONCONTROLISGRAYING = "OperationDenied.VersionControlIsGraying"
RESOURCEINUSE = "ResourceInUse"
RESOURCEUNAVAILABLE_DOMAINNOTFOUND = "ResourceUnavailable.DomainNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DeleteAliasDomain 

func (c *Client) DeleteAliasDomain(request *DeleteAliasDomainRequest) (response *DeleteAliasDomainResponse, err error)

DeleteAliasDomain This API is used to delete an alias domain name.

error code that may be returned: 

INTERNALERROR = "InternalError"
OPERATIONDENIED = "OperationDenied"
RESOURCEINUSE = "ResourceInUse"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) DeleteAliasDomainWithContext 

func (c *Client) DeleteAliasDomainWithContext(ctx context.Context, request *DeleteAliasDomainRequest) (response *DeleteAliasDomainResponse, err error)

DeleteAliasDomain This API is used to delete an alias domain name.

error code that may be returned: 

INTERNALERROR = "InternalError"
OPERATIONDENIED = "OperationDenied"
RESOURCEINUSE = "ResourceInUse"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) DeleteApplicationProxy 

func (c *Client) DeleteApplicationProxy(request *DeleteApplicationProxyRequest) (response *DeleteApplicationProxyResponse, err error)

DeleteApplicationProxy This API is on an earlier version. If you want to call it, please switch to the latest version. For details, see [DeleteL4Proxy] (https://intl.cloud.tencent.com/document/product/1552/103415?from_cn_redirect=1).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DeleteApplicationProxyRule 

func (c *Client) DeleteApplicationProxyRule(request *DeleteApplicationProxyRuleRequest) (response *DeleteApplicationProxyRuleResponse, err error)

DeleteApplicationProxyRule This API is on an earlier version. If you want to call it, please switch to the latest version. For details, see [DeleteL4ProxyRules] (https://intl.cloud.tencent.com/document/product/1552/103414?from_cn_redirect=1).

error code that may be returned: 

RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNSUPPORTEDOPERATION = "UnsupportedOperation"

func (*Client) DeleteApplicationProxyRuleWithContext 

func (c *Client) DeleteApplicationProxyRuleWithContext(ctx context.Context, request *DeleteApplicationProxyRuleRequest) (response *DeleteApplicationProxyRuleResponse, err error)

DeleteApplicationProxyRule This API is on an earlier version. If you want to call it, please switch to the latest version. For details, see [DeleteL4ProxyRules] (https://intl.cloud.tencent.com/document/product/1552/103414?from_cn_redirect=1).

error code that may be returned: 

RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNSUPPORTEDOPERATION = "UnsupportedOperation"

func (*Client) DeleteApplicationProxyWithContext 

func (c *Client) DeleteApplicationProxyWithContext(ctx context.Context, request *DeleteApplicationProxyRequest) (response *DeleteApplicationProxyResponse, err error)

DeleteApplicationProxy This API is on an earlier version. If you want to call it, please switch to the latest version. For details, see [DeleteL4Proxy] (https://intl.cloud.tencent.com/document/product/1552/103415?from_cn_redirect=1).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DeleteCustomErrorPage 

func (c *Client) DeleteCustomErrorPage(request *DeleteCustomErrorPageRequest) (response *DeleteCustomErrorPageResponse, err error)

DeleteCustomErrorPage This API is used to delete a custom response page.

error code that may be returned: 

RESOURCEINUSE = "ResourceInUse"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) DeleteCustomErrorPageWithContext 

func (c *Client) DeleteCustomErrorPageWithContext(ctx context.Context, request *DeleteCustomErrorPageRequest) (response *DeleteCustomErrorPageResponse, err error)

DeleteCustomErrorPage This API is used to delete a custom response page.

error code that may be returned: 

RESOURCEINUSE = "ResourceInUse"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) DeleteFunction 

func (c *Client) DeleteFunction(request *DeleteFunctionRequest) (response *DeleteFunctionResponse, err error)

DeleteFunction This API is used to delete an edge function. Once deleted, the function cannot be recovered, and associated trigger rules are also deleted.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_RULEOPERATIONCONFLICT = "FailedOperation.RuleOperationConflict"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
OPERATIONDENIED_VERSIONCONTROLLOCKED = "OperationDenied.VersionControlLocked"
RESOURCEUNAVAILABLE_FUNCTIONNOTFOUND = "ResourceUnavailable.FunctionNotFound"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

func (*Client) DeleteFunctionRules 

func (c *Client) DeleteFunctionRules(request *DeleteFunctionRulesRequest) (response *DeleteFunctionRulesResponse, err error)

DeleteFunctionRules This API is used to delete a trigger rule for an edge function.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_RULEOPERATIONCONFLICT = "FailedOperation.RuleOperationConflict"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
RESOURCEUNAVAILABLE_RULENOTFOUND = "ResourceUnavailable.RuleNotFound"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

func (*Client) DeleteFunctionRulesWithContext 

func (c *Client) DeleteFunctionRulesWithContext(ctx context.Context, request *DeleteFunctionRulesRequest) (response *DeleteFunctionRulesResponse, err error)

DeleteFunctionRules This API is used to delete a trigger rule for an edge function.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_RULEOPERATIONCONFLICT = "FailedOperation.RuleOperationConflict"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
RESOURCEUNAVAILABLE_RULENOTFOUND = "ResourceUnavailable.RuleNotFound"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

func (*Client) DeleteFunctionWithContext 

func (c *Client) DeleteFunctionWithContext(ctx context.Context, request *DeleteFunctionRequest) (response *DeleteFunctionResponse, err error)

DeleteFunction This API is used to delete an edge function. Once deleted, the function cannot be recovered, and associated trigger rules are also deleted.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_RULEOPERATIONCONFLICT = "FailedOperation.RuleOperationConflict"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
OPERATIONDENIED_VERSIONCONTROLLOCKED = "OperationDenied.VersionControlLocked"
RESOURCEUNAVAILABLE_FUNCTIONNOTFOUND = "ResourceUnavailable.FunctionNotFound"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

func (*Client) DeleteL4Proxy 

func (c *Client) DeleteL4Proxy(request *DeleteL4ProxyRequest) (response *DeleteL4ProxyResponse, err error)

DeleteL4Proxy This API is used to delete a Layer 4 proxy instance.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DeleteL4ProxyRules 

func (c *Client) DeleteL4ProxyRules(request *DeleteL4ProxyRulesRequest) (response *DeleteL4ProxyRulesResponse, err error)

DeleteL4ProxyRules This API is used to delete Layer 4 proxy forwarding rules, supporting both individual and batch operation.

error code that may be returned: 

RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNSUPPORTEDOPERATION = "UnsupportedOperation"

func (*Client) DeleteL4ProxyRulesWithContext 

func (c *Client) DeleteL4ProxyRulesWithContext(ctx context.Context, request *DeleteL4ProxyRulesRequest) (response *DeleteL4ProxyRulesResponse, err error)

DeleteL4ProxyRules This API is used to delete Layer 4 proxy forwarding rules, supporting both individual and batch operation.

error code that may be returned: 

RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNSUPPORTEDOPERATION = "UnsupportedOperation"

func (*Client) DeleteL4ProxyWithContext 

func (c *Client) DeleteL4ProxyWithContext(ctx context.Context, request *DeleteL4ProxyRequest) (response *DeleteL4ProxyResponse, err error)

DeleteL4Proxy This API is used to delete a Layer 4 proxy instance.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DeleteLoadBalancer 

func (c *Client) DeleteLoadBalancer(request *DeleteLoadBalancerRequest) (response *DeleteLoadBalancerResponse, err error)

DeleteLoadBalancer This API is used to delete a LoadBalancer. If the LoadBalancer is referenced by other services (for example, Layer-4 proxy), the LoadBalancer cannot be deleted until the reference relationship is removed. The load balancing feature is in beta test. If you need to use it, [contact us](https://intl.cloud.tencent.com/online?from_cn_redirect=1-service).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INVALIDPARAMETER_LOADBALANCERUSEDINL4PROXY = "InvalidParameter.LoadBalancerUsedInL4Proxy"
INVALIDPARAMETER_LOADBALANCERUSEDINL7DOMAIN = "InvalidParameter.LoadBalancerUsedInL7Domain"
INVALIDPARAMETER_LOADBALANCERUSEDINRULEENGINE = "InvalidParameter.LoadBalancerUsedInRuleEngine"

func (*Client) DeleteLoadBalancerWithContext 

func (c *Client) DeleteLoadBalancerWithContext(ctx context.Context, request *DeleteLoadBalancerRequest) (response *DeleteLoadBalancerResponse, err error)

DeleteLoadBalancer This API is used to delete a LoadBalancer. If the LoadBalancer is referenced by other services (for example, Layer-4 proxy), the LoadBalancer cannot be deleted until the reference relationship is removed. The load balancing feature is in beta test. If you need to use it, [contact us](https://intl.cloud.tencent.com/online?from_cn_redirect=1-service).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INVALIDPARAMETER_LOADBALANCERUSEDINL4PROXY = "InvalidParameter.LoadBalancerUsedInL4Proxy"
INVALIDPARAMETER_LOADBALANCERUSEDINL7DOMAIN = "InvalidParameter.LoadBalancerUsedInL7Domain"
INVALIDPARAMETER_LOADBALANCERUSEDINRULEENGINE = "InvalidParameter.LoadBalancerUsedInRuleEngine"

func (*Client) DeleteOriginGroup 

func (c *Client) DeleteOriginGroup(request *DeleteOriginGroupRequest) (response *DeleteOriginGroupResponse, err error)

DeleteOriginGroup This API is used to delete an origin group. Note that an origin group can not be deleted if it is referenced by services (e.g. L4 Proxy, domain name service, load balancing, rule engines).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ORIGINGROUPACCELERATIONDOMAINUSED = "OperationDenied.OriginGroupAccelerationDomainUsed"
OPERATIONDENIED_ORIGINGROUPL4USED = "OperationDenied.OriginGroupL4Used"
OPERATIONDENIED_ORIGINGROUPLBUSED = "OperationDenied.OriginGroupLBUsed"
OPERATIONDENIED_ORIGINGROUPRULEENGINEUSED = "OperationDenied.OriginGroupRuleEngineUsed"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DeleteOriginGroupWithContext 

func (c *Client) DeleteOriginGroupWithContext(ctx context.Context, request *DeleteOriginGroupRequest) (response *DeleteOriginGroupResponse, err error)

DeleteOriginGroup This API is used to delete an origin group. Note that an origin group can not be deleted if it is referenced by services (e.g. L4 Proxy, domain name service, load balancing, rule engines).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ORIGINGROUPACCELERATIONDOMAINUSED = "OperationDenied.OriginGroupAccelerationDomainUsed"
OPERATIONDENIED_ORIGINGROUPL4USED = "OperationDenied.OriginGroupL4Used"
OPERATIONDENIED_ORIGINGROUPLBUSED = "OperationDenied.OriginGroupLBUsed"
OPERATIONDENIED_ORIGINGROUPRULEENGINEUSED = "OperationDenied.OriginGroupRuleEngineUsed"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DeleteRealtimeLogDeliveryTask 

func (c *Client) DeleteRealtimeLogDeliveryTask(request *DeleteRealtimeLogDeliveryTaskRequest) (response *DeleteRealtimeLogDeliveryTaskResponse, err error)

DeleteRealtimeLogDeliveryTask This API is used to delete a real-time log delivery task.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"

func (*Client) DeleteRealtimeLogDeliveryTaskWithContext 

func (c *Client) DeleteRealtimeLogDeliveryTaskWithContext(ctx context.Context, request *DeleteRealtimeLogDeliveryTaskRequest) (response *DeleteRealtimeLogDeliveryTaskResponse, err error)

DeleteRealtimeLogDeliveryTask This API is used to delete a real-time log delivery task.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"

func (*Client) DeleteRules 

func (c *Client) DeleteRules(request *DeleteRulesRequest) (response *DeleteRulesResponse, err error)

DeleteRules This API is used to batch delete rules from the rule engine.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_ACTIONINPROGRESS = "InvalidParameter.ActionInProgress"
INVALIDPARAMETER_ERRINVALIDACTIONPARAM = "InvalidParameter.ErrInvalidActionParam"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMVALUE = "InvalidParameter.ErrInvalidActionParamValue"
INVALIDPARAMETER_INVALIDHTTPS = "InvalidParameter.InvalidHttps"
INVALIDPARAMETER_INVALIDHTTPSCIPHERSUITEANDTLSVERSION = "InvalidParameter.InvalidHttpsCipherSuiteAndTlsVersion"
INVALIDPARAMETER_INVALIDRANGEORIGINPULL = "InvalidParameter.InvalidRangeOriginPull"
INVALIDPARAMETER_INVALIDRULEENGINENOTFOUND = "InvalidParameter.InvalidRuleEngineNotFound"
INVALIDPARAMETER_NOTSUPPORTTHISPRESET = "InvalidParameter.NotSupportThisPreset"
INVALIDPARAMETER_ZONENOTFOUND = "InvalidParameter.ZoneNotFound"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
RESOURCEINUSE = "ResourceInUse"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DeleteRulesWithContext 

func (c *Client) DeleteRulesWithContext(ctx context.Context, request *DeleteRulesRequest) (response *DeleteRulesResponse, err error)

DeleteRules This API is used to batch delete rules from the rule engine.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_ACTIONINPROGRESS = "InvalidParameter.ActionInProgress"
INVALIDPARAMETER_ERRINVALIDACTIONPARAM = "InvalidParameter.ErrInvalidActionParam"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMVALUE = "InvalidParameter.ErrInvalidActionParamValue"
INVALIDPARAMETER_INVALIDHTTPS = "InvalidParameter.InvalidHttps"
INVALIDPARAMETER_INVALIDHTTPSCIPHERSUITEANDTLSVERSION = "InvalidParameter.InvalidHttpsCipherSuiteAndTlsVersion"
INVALIDPARAMETER_INVALIDRANGEORIGINPULL = "InvalidParameter.InvalidRangeOriginPull"
INVALIDPARAMETER_INVALIDRULEENGINENOTFOUND = "InvalidParameter.InvalidRuleEngineNotFound"
INVALIDPARAMETER_NOTSUPPORTTHISPRESET = "InvalidParameter.NotSupportThisPreset"
INVALIDPARAMETER_ZONENOTFOUND = "InvalidParameter.ZoneNotFound"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
RESOURCEINUSE = "ResourceInUse"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DeleteSecurityIPGroup 

func (c *Client) DeleteSecurityIPGroup(request *DeleteSecurityIPGroupRequest) (response *DeleteSecurityIPGroupResponse, err error)

DeleteSecurityIPGroup This API is used to delete a specified security IP group. Note that the security IP group cannot be deleted if it is referenced in a rule.

error code that may be returned: 

INVALIDPARAMETER_SECURITY = "InvalidParameter.Security"
OPERATIONDENIED = "OperationDenied"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DeleteSecurityIPGroupWithContext 

func (c *Client) DeleteSecurityIPGroupWithContext(ctx context.Context, request *DeleteSecurityIPGroupRequest) (response *DeleteSecurityIPGroupResponse, err error)

DeleteSecurityIPGroup This API is used to delete a specified security IP group. Note that the security IP group cannot be deleted if it is referenced in a rule.

error code that may be returned: 

INVALIDPARAMETER_SECURITY = "InvalidParameter.Security"
OPERATIONDENIED = "OperationDenied"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DeleteSharedCNAME 

func (c *Client) DeleteSharedCNAME(request *DeleteSharedCNAMERequest) (response *DeleteSharedCNAMEResponse, err error)

DeleteSharedCNAME This API is used to delete a shared CNAME. It is now only available to beta users.

error code that may be returned: 

RESOURCEINUSE_SHAREDCNAME = "ResourceInUse.SharedCNAME"

func (*Client) DeleteSharedCNAMEWithContext 

func (c *Client) DeleteSharedCNAMEWithContext(ctx context.Context, request *DeleteSharedCNAMERequest) (response *DeleteSharedCNAMEResponse, err error)

DeleteSharedCNAME This API is used to delete a shared CNAME. It is now only available to beta users.

error code that may be returned: 

RESOURCEINUSE_SHAREDCNAME = "ResourceInUse.SharedCNAME"

func (*Client) DeleteZone 

func (c *Client) DeleteZone(request *DeleteZoneRequest) (response *DeleteZoneResponse, err error)

DeleteZone This API is used to delete a site.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_DELETEZONEPRECHECKFAILED = "OperationDenied.DeleteZonePreCheckFailed"
OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"
OPERATIONDENIED_ZONEISBINDINGSHAREDCNAME = "OperationDenied.ZoneIsBindingSharedCNAME"
OPERATIONDENIED_ZONEISREFERENCECUSTOMERRORPAGE = "OperationDenied.ZoneIsReferenceCustomErrorPage"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DeleteZoneWithContext 

func (c *Client) DeleteZoneWithContext(ctx context.Context, request *DeleteZoneRequest) (response *DeleteZoneResponse, err error)

DeleteZone This API is used to delete a site.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_DELETEZONEPRECHECKFAILED = "OperationDenied.DeleteZonePreCheckFailed"
OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"
OPERATIONDENIED_ZONEISBINDINGSHAREDCNAME = "OperationDenied.ZoneIsBindingSharedCNAME"
OPERATIONDENIED_ZONEISREFERENCECUSTOMERRORPAGE = "OperationDenied.ZoneIsReferenceCustomErrorPage"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DeployConfigGroupVersion 

func (c *Client) DeployConfigGroupVersion(request *DeployConfigGroupVersionRequest) (response *DeployConfigGroupVersionResponse, err error)

DeployConfigGroupVersion This API is used to release versions in version management mode. Users can deploy the version to either the testing environment or the production environment by specifying the EnvId parameter. The version management feature is currently undergoing beta testing and is accessible only to users on the whitelist.

error code that may be returned: 

FAILEDOPERATION_CONFIGCONDITIONSYNTAXERROR = "FailedOperation.ConfigConditionSyntaxError"
FAILEDOPERATION_CONFIGCONDITIONUNKNOWNTARGET = "FailedOperation.ConfigConditionUnknownTarget"
FAILEDOPERATION_CONFIGCONDITIONVALUEEMPTYERROR = "FailedOperation.ConfigConditionValueEmptyError"
FAILEDOPERATION_CONFIGFIELDTYPEERROR = "FailedOperation.ConfigFieldTypeError"
FAILEDOPERATION_CONFIGFORMATERROR = "FailedOperation.ConfigFormatError"
FAILEDOPERATION_CONFIGMALFORMEDCONTENT = "FailedOperation.ConfigMalformedContent"
FAILEDOPERATION_CONFIGPARAMVALIDATEERRORS = "FailedOperation.ConfigParamValidateErrors"
FAILEDOPERATION_CONFIGUNKNOWNFIELD = "FailedOperation.ConfigUnknownField"
FAILEDOPERATION_CONFIGUNSUPPORTEDFORMATVERSION = "FailedOperation.ConfigUnsupportedFormatVersion"
INVALIDPARAMETER_ZONENOTFOUND = "InvalidParameter.ZoneNotFound"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_DOMAINSTATUSUNSTABLE = "OperationDenied.DomainStatusUnstable"
OPERATIONDENIED_ENVNOTREADY = "OperationDenied.EnvNotReady"
OPERATIONDENIED_NOTINVERSIONCONTROLWHITELIST = "OperationDenied.NotInVersionControlWhiteList"
OPERATIONDENIED_VERSIONCONTROLLOCKED = "OperationDenied.VersionControlLocked"
OPERATIONDENIED_WORKMODENOTINVERSIONCONTROL = "OperationDenied.WorkModeNotInVersionControl"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCENOTFOUND_VERSIONNOTFOUND = "ResourceNotFound.VersionNotFound"

func (*Client) DeployConfigGroupVersionWithContext 

func (c *Client) DeployConfigGroupVersionWithContext(ctx context.Context, request *DeployConfigGroupVersionRequest) (response *DeployConfigGroupVersionResponse, err error)

DeployConfigGroupVersion This API is used to release versions in version management mode. Users can deploy the version to either the testing environment or the production environment by specifying the EnvId parameter. The version management feature is currently undergoing beta testing and is accessible only to users on the whitelist.

error code that may be returned: 

FAILEDOPERATION_CONFIGCONDITIONSYNTAXERROR = "FailedOperation.ConfigConditionSyntaxError"
FAILEDOPERATION_CONFIGCONDITIONUNKNOWNTARGET = "FailedOperation.ConfigConditionUnknownTarget"
FAILEDOPERATION_CONFIGCONDITIONVALUEEMPTYERROR = "FailedOperation.ConfigConditionValueEmptyError"
FAILEDOPERATION_CONFIGFIELDTYPEERROR = "FailedOperation.ConfigFieldTypeError"
FAILEDOPERATION_CONFIGFORMATERROR = "FailedOperation.ConfigFormatError"
FAILEDOPERATION_CONFIGMALFORMEDCONTENT = "FailedOperation.ConfigMalformedContent"
FAILEDOPERATION_CONFIGPARAMVALIDATEERRORS = "FailedOperation.ConfigParamValidateErrors"
FAILEDOPERATION_CONFIGUNKNOWNFIELD = "FailedOperation.ConfigUnknownField"
FAILEDOPERATION_CONFIGUNSUPPORTEDFORMATVERSION = "FailedOperation.ConfigUnsupportedFormatVersion"
INVALIDPARAMETER_ZONENOTFOUND = "InvalidParameter.ZoneNotFound"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_DOMAINSTATUSUNSTABLE = "OperationDenied.DomainStatusUnstable"
OPERATIONDENIED_ENVNOTREADY = "OperationDenied.EnvNotReady"
OPERATIONDENIED_NOTINVERSIONCONTROLWHITELIST = "OperationDenied.NotInVersionControlWhiteList"
OPERATIONDENIED_VERSIONCONTROLLOCKED = "OperationDenied.VersionControlLocked"
OPERATIONDENIED_WORKMODENOTINVERSIONCONTROL = "OperationDenied.WorkModeNotInVersionControl"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCENOTFOUND_VERSIONNOTFOUND = "ResourceNotFound.VersionNotFound"

func (*Client) DescribeAccelerationDomains 

func (c *Client) DescribeAccelerationDomains(request *DescribeAccelerationDomainsRequest) (response *DescribeAccelerationDomainsResponse, err error)

DescribeAccelerationDomains This API is used to query domain name information of a site, including the acceleration domain name, origin, and domain name status. You can query the information of all domain names, or specific domain names by specifying filters information.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INVALIDPARAMETER_DOMAINONTRAFFICSCHEDULING = "InvalidParameter.DomainOnTrafficScheduling"
INVALIDPARAMETER_TOOMANYFILTERVALUES = "InvalidParameter.TooManyFilterValues"
OPERATIONDENIED = "OperationDenied"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeAccelerationDomainsWithContext 

func (c *Client) DescribeAccelerationDomainsWithContext(ctx context.Context, request *DescribeAccelerationDomainsRequest) (response *DescribeAccelerationDomainsResponse, err error)

DescribeAccelerationDomains This API is used to query domain name information of a site, including the acceleration domain name, origin, and domain name status. You can query the information of all domain names, or specific domain names by specifying filters information.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INVALIDPARAMETER_DOMAINONTRAFFICSCHEDULING = "InvalidParameter.DomainOnTrafficScheduling"
INVALIDPARAMETER_TOOMANYFILTERVALUES = "InvalidParameter.TooManyFilterValues"
OPERATIONDENIED = "OperationDenied"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeAliasDomains 

func (c *Client) DescribeAliasDomains(request *DescribeAliasDomainsRequest) (response *DescribeAliasDomainsResponse, err error)

DescribeAliasDomains This API is used to query the information of alias domain names.

error code that may be returned: 

INTERNALERROR = "InternalError"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeAliasDomainsWithContext 

func (c *Client) DescribeAliasDomainsWithContext(ctx context.Context, request *DescribeAliasDomainsRequest) (response *DescribeAliasDomainsResponse, err error)

DescribeAliasDomains This API is used to query the information of alias domain names.

error code that may be returned: 

INTERNALERROR = "InternalError"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeApplicationProxies 

func (c *Client) DescribeApplicationProxies(request *DescribeApplicationProxiesRequest) (response *DescribeApplicationProxiesResponse, err error)

DescribeApplicationProxies This API is on an earlier version. If you want to call it, please switch to the latest version. In the latest version, this API has been split into two APIs: one for querying the Layer 4 proxy instance list and the other for querying Layer 4 forwarding rules. For details, see [DescribeL4Proxy] (https://intl.cloud.tencent.com/document/product/1552/103413?from_cn_redirect=1) and [DescribeL4ProxyRules] (https://intl.cloud.tencent.com/document/product/1552/103412?from_cn_redirect=1).

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
OPERATIONDENIED = "OperationDenied"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeApplicationProxiesWithContext 

func (c *Client) DescribeApplicationProxiesWithContext(ctx context.Context, request *DescribeApplicationProxiesRequest) (response *DescribeApplicationProxiesResponse, err error)

DescribeApplicationProxies This API is on an earlier version. If you want to call it, please switch to the latest version. In the latest version, this API has been split into two APIs: one for querying the Layer 4 proxy instance list and the other for querying Layer 4 forwarding rules. For details, see [DescribeL4Proxy] (https://intl.cloud.tencent.com/document/product/1552/103413?from_cn_redirect=1) and [DescribeL4ProxyRules] (https://intl.cloud.tencent.com/document/product/1552/103412?from_cn_redirect=1).

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
OPERATIONDENIED = "OperationDenied"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeAvailablePlans 

func (c *Client) DescribeAvailablePlans(request *DescribeAvailablePlansRequest) (response *DescribeAvailablePlansResponse, err error)

DescribeAvailablePlans This API is used to query plan options available for purchase.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"

func (*Client) DescribeAvailablePlansWithContext 

func (c *Client) DescribeAvailablePlansWithContext(ctx context.Context, request *DescribeAvailablePlansRequest) (response *DescribeAvailablePlansResponse, err error)

DescribeAvailablePlans This API is used to query plan options available for purchase.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"

func (*Client) DescribeBillingData 

func (c *Client) DescribeBillingData(request *DescribeBillingDataRequest) (response *DescribeBillingDataResponse, err error)

DescribeBillingData This API is used to query billing data.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INVALIDPARAMETER_INVALIDINTERVAL = "InvalidParameter.InvalidInterval"
INVALIDPARAMETER_INVALIDMETRIC = "InvalidParameter.InvalidMetric"
INVALIDPARAMETER_ZONEHASNOTBEENBOUNDTOPLAN = "InvalidParameter.ZoneHasNotBeenBoundToPlan"

func (*Client) DescribeBillingDataWithContext 

func (c *Client) DescribeBillingDataWithContext(ctx context.Context, request *DescribeBillingDataRequest) (response *DescribeBillingDataResponse, err error)

DescribeBillingData This API is used to query billing data.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INVALIDPARAMETER_INVALIDINTERVAL = "InvalidParameter.InvalidInterval"
INVALIDPARAMETER_INVALIDMETRIC = "InvalidParameter.InvalidMetric"
INVALIDPARAMETER_ZONEHASNOTBEENBOUNDTOPLAN = "InvalidParameter.ZoneHasNotBeenBoundToPlan"

func (*Client) DescribeConfigGroupVersionDetail 

func (c *Client) DescribeConfigGroupVersionDetail(request *DescribeConfigGroupVersionDetailRequest) (response *DescribeConfigGroupVersionDetailResponse, err error)

DescribeConfigGroupVersionDetail This API is used to obtain detailed information about a version in version management mode. The response includes the version ID, description, status, creation time, configuration group information, and the content of the version configuration file. The version management feature is currently undergoing beta testing and is accessible only to users on the whitelist.

error code that may be returned: 

RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) DescribeConfigGroupVersionDetailWithContext 

func (c *Client) DescribeConfigGroupVersionDetailWithContext(ctx context.Context, request *DescribeConfigGroupVersionDetailRequest) (response *DescribeConfigGroupVersionDetailResponse, err error)

DescribeConfigGroupVersionDetail This API is used to obtain detailed information about a version in version management mode. The response includes the version ID, description, status, creation time, configuration group information, and the content of the version configuration file. The version management feature is currently undergoing beta testing and is accessible only to users on the whitelist.

error code that may be returned: 

RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) DescribeConfigGroupVersions 

func (c *Client) DescribeConfigGroupVersions(request *DescribeConfigGroupVersionsRequest) (response *DescribeConfigGroupVersionsResponse, err error)

DescribeConfigGroupVersions This API is used to query the version list for the specified configuration group in version management mode. The version management feature is currently undergoing beta testing and is accessible only to users on the whitelist.

error code that may be returned: 

RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) DescribeConfigGroupVersionsWithContext 

func (c *Client) DescribeConfigGroupVersionsWithContext(ctx context.Context, request *DescribeConfigGroupVersionsRequest) (response *DescribeConfigGroupVersionsResponse, err error)

DescribeConfigGroupVersions This API is used to query the version list for the specified configuration group in version management mode. The version management feature is currently undergoing beta testing and is accessible only to users on the whitelist.

error code that may be returned: 

RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) DescribeContentQuota 

func (c *Client) DescribeContentQuota(request *DescribeContentQuotaRequest) (response *DescribeContentQuotaResponse, err error)

DescribeContentQuota This API is used to query content management quotas.

error code that may be returned: 

UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeContentQuotaWithContext 

func (c *Client) DescribeContentQuotaWithContext(ctx context.Context, request *DescribeContentQuotaRequest) (response *DescribeContentQuotaResponse, err error)

DescribeContentQuota This API is used to query content management quotas.

error code that may be returned: 

UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeCustomErrorPages 

func (c *Client) DescribeCustomErrorPages(request *DescribeCustomErrorPagesRequest) (response *DescribeCustomErrorPagesResponse, err error)

DescribeCustomErrorPages This API is used to query the custom response page list.

error code that may be returned: 

INTERNALERROR_ROUTEERROR = "InternalError.RouteError"

func (*Client) DescribeCustomErrorPagesWithContext 

func (c *Client) DescribeCustomErrorPagesWithContext(ctx context.Context, request *DescribeCustomErrorPagesRequest) (response *DescribeCustomErrorPagesResponse, err error)

DescribeCustomErrorPages This API is used to query the custom response page list.

error code that may be returned: 

INTERNALERROR_ROUTEERROR = "InternalError.RouteError"

func (*Client) DescribeDDoSAttackData 

func (c *Client) DescribeDDoSAttackData(request *DescribeDDoSAttackDataRequest) (response *DescribeDDoSAttackDataResponse, err error)

DescribeDDoSAttackData This API is used to query the time-series data of DDoS attacks.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
LIMITEXCEEDED = "LimitExceeded"
LIMITEXCEEDED_QUERYTIMELIMITEXCEEDED = "LimitExceeded.QueryTimeLimitExceeded"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"

func (*Client) DescribeDDoSAttackDataWithContext 

func (c *Client) DescribeDDoSAttackDataWithContext(ctx context.Context, request *DescribeDDoSAttackDataRequest) (response *DescribeDDoSAttackDataResponse, err error)

DescribeDDoSAttackData This API is used to query the time-series data of DDoS attacks.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
LIMITEXCEEDED = "LimitExceeded"
LIMITEXCEEDED_QUERYTIMELIMITEXCEEDED = "LimitExceeded.QueryTimeLimitExceeded"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"

func (*Client) DescribeDDoSAttackEvent 

func (c *Client) DescribeDDoSAttackEvent(request *DescribeDDoSAttackEventRequest) (response *DescribeDDoSAttackEventResponse, err error)

DescribeDDoSAttackEvent This API is used to query DDoS attack events.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
LIMITEXCEEDED = "LimitExceeded"
LIMITEXCEEDED_QUERYTIMELIMITEXCEEDED = "LimitExceeded.QueryTimeLimitExceeded"
OPERATIONDENIED = "OperationDenied"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DescribeDDoSAttackEventWithContext 

func (c *Client) DescribeDDoSAttackEventWithContext(ctx context.Context, request *DescribeDDoSAttackEventRequest) (response *DescribeDDoSAttackEventResponse, err error)

DescribeDDoSAttackEvent This API is used to query DDoS attack events.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
LIMITEXCEEDED = "LimitExceeded"
LIMITEXCEEDED_QUERYTIMELIMITEXCEEDED = "LimitExceeded.QueryTimeLimitExceeded"
OPERATIONDENIED = "OperationDenied"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DescribeDDoSAttackTopData 

func (c *Client) DescribeDDoSAttackTopData(request *DescribeDDoSAttackTopDataRequest) (response *DescribeDDoSAttackTopDataResponse, err error)

DescribeDDoSAttackTopData This API is used to query the top-ranked DDoS attack data.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
LIMITEXCEEDED_QUERYTIMELIMITEXCEEDED = "LimitExceeded.QueryTimeLimitExceeded"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DescribeDDoSAttackTopDataWithContext 

func (c *Client) DescribeDDoSAttackTopDataWithContext(ctx context.Context, request *DescribeDDoSAttackTopDataRequest) (response *DescribeDDoSAttackTopDataResponse, err error)

DescribeDDoSAttackTopData This API is used to query the top-ranked DDoS attack data.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
LIMITEXCEEDED_QUERYTIMELIMITEXCEEDED = "LimitExceeded.QueryTimeLimitExceeded"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DescribeDefaultCertificates 

func (c *Client) DescribeDefaultCertificates(request *DescribeDefaultCertificatesRequest) (response *DescribeDefaultCertificatesResponse, err error)

DescribeDefaultCertificates This API is used to query a list of default certificates.

error code that may be returned: 

INTERNALERROR_DBERROR = "InternalError.DBError"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_ZONENOTFOUND = "InvalidParameter.ZoneNotFound"
OPERATIONDENIED = "OperationDenied"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"

func (*Client) DescribeDefaultCertificatesWithContext 

func (c *Client) DescribeDefaultCertificatesWithContext(ctx context.Context, request *DescribeDefaultCertificatesRequest) (response *DescribeDefaultCertificatesResponse, err error)

DescribeDefaultCertificates This API is used to query a list of default certificates.

error code that may be returned: 

INTERNALERROR_DBERROR = "InternalError.DBError"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_ZONENOTFOUND = "InvalidParameter.ZoneNotFound"
OPERATIONDENIED = "OperationDenied"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"

func (*Client) DescribeDeployHistory 

func (c *Client) DescribeDeployHistory(request *DescribeDeployHistoryRequest) (response *DescribeDeployHistoryResponse, err error)

DescribeDeployHistory This API is used to query the release history of versions in the production or test environment in version management mode. The version management feature is currently undergoing beta testing and is accessible only to users on the whitelist.

error code that may be returned: 

RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) DescribeDeployHistoryWithContext 

func (c *Client) DescribeDeployHistoryWithContext(ctx context.Context, request *DescribeDeployHistoryRequest) (response *DescribeDeployHistoryResponse, err error)

DescribeDeployHistory This API is used to query the release history of versions in the production or test environment in version management mode. The version management feature is currently undergoing beta testing and is accessible only to users on the whitelist.

error code that may be returned: 

RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) DescribeEnvironments 

func (c *Client) DescribeEnvironments(request *DescribeEnvironmentsRequest) (response *DescribeEnvironmentsResponse, err error)

DescribeEnvironments This API is used to query environment information in version management mode. The response includes the environment ID, type, and current effective version. The version management feature is currently undergoing beta testing and is accessible only to users on the whitelist.

error code that may be returned: 

RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) DescribeEnvironmentsWithContext 

func (c *Client) DescribeEnvironmentsWithContext(ctx context.Context, request *DescribeEnvironmentsRequest) (response *DescribeEnvironmentsResponse, err error)

DescribeEnvironments This API is used to query environment information in version management mode. The response includes the environment ID, type, and current effective version. The version management feature is currently undergoing beta testing and is accessible only to users on the whitelist.

error code that may be returned: 

RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) DescribeFunctionRules 

func (c *Client) DescribeFunctionRules(request *DescribeFunctionRulesRequest) (response *DescribeFunctionRulesResponse, err error)

DescribeFunctionRules This API is used to query the list of trigger rules for an edge function. It supports filtering by rule ID, function ID, rule description, and so on.

error code that may be returned: 

INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_INVALIDFILTERNAME = "InvalidParameter.InvalidFilterName"
INVALIDPARAMETER_TOOMANYFILTERVALUES = "InvalidParameter.TooManyFilterValues"
INVALIDPARAMETER_TOOMANYFILTERS = "InvalidParameter.TooManyFilters"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

func (*Client) DescribeFunctionRulesWithContext 

func (c *Client) DescribeFunctionRulesWithContext(ctx context.Context, request *DescribeFunctionRulesRequest) (response *DescribeFunctionRulesResponse, err error)

DescribeFunctionRules This API is used to query the list of trigger rules for an edge function. It supports filtering by rule ID, function ID, rule description, and so on.

error code that may be returned: 

INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_INVALIDFILTERNAME = "InvalidParameter.InvalidFilterName"
INVALIDPARAMETER_TOOMANYFILTERVALUES = "InvalidParameter.TooManyFilterValues"
INVALIDPARAMETER_TOOMANYFILTERS = "InvalidParameter.TooManyFilters"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

func (*Client) DescribeFunctionRuntimeEnvironment 

func (c *Client) DescribeFunctionRuntimeEnvironment(request *DescribeFunctionRuntimeEnvironmentRequest) (response *DescribeFunctionRuntimeEnvironmentResponse, err error)

DescribeFunctionRuntimeEnvironment This API is used to query the runtime environment of an edge function, including environment variables.

error code that may be returned: 

INTERNALERROR_DBERROR = "InternalError.DBError"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_INVALIDFILTERNAME = "InvalidParameter.InvalidFilterName"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

func (*Client) DescribeFunctionRuntimeEnvironmentWithContext 

func (c *Client) DescribeFunctionRuntimeEnvironmentWithContext(ctx context.Context, request *DescribeFunctionRuntimeEnvironmentRequest) (response *DescribeFunctionRuntimeEnvironmentResponse, err error)

DescribeFunctionRuntimeEnvironment This API is used to query the runtime environment of an edge function, including environment variables.

error code that may be returned: 

INTERNALERROR_DBERROR = "InternalError.DBError"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_INVALIDFILTERNAME = "InvalidParameter.InvalidFilterName"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

func (*Client) DescribeFunctions 

func (c *Client) DescribeFunctions(request *DescribeFunctionsRequest) (response *DescribeFunctionsResponse, err error)

DescribeFunctions This API is used to query the list of edge functions. It supports filtering by function ID, name, description, and so on.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_INVALIDFILTERNAME = "InvalidParameter.InvalidFilterName"
INVALIDPARAMETER_LENGTHEXCEEDSLIMIT = "InvalidParameter.LengthExceedsLimit"
INVALIDPARAMETER_TOOMANYFILTERVALUES = "InvalidParameter.TooManyFilterValues"
INVALIDPARAMETER_TOOMANYFILTERS = "InvalidParameter.TooManyFilters"
RESOURCEUNAVAILABLE_FUNCTIONNOTFOUND = "ResourceUnavailable.FunctionNotFound"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

func (*Client) DescribeFunctionsWithContext 

func (c *Client) DescribeFunctionsWithContext(ctx context.Context, request *DescribeFunctionsRequest) (response *DescribeFunctionsResponse, err error)

DescribeFunctions This API is used to query the list of edge functions. It supports filtering by function ID, name, description, and so on.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_INVALIDFILTERNAME = "InvalidParameter.InvalidFilterName"
INVALIDPARAMETER_LENGTHEXCEEDSLIMIT = "InvalidParameter.LengthExceedsLimit"
INVALIDPARAMETER_TOOMANYFILTERVALUES = "InvalidParameter.TooManyFilterValues"
INVALIDPARAMETER_TOOMANYFILTERS = "InvalidParameter.TooManyFilters"
RESOURCEUNAVAILABLE_FUNCTIONNOTFOUND = "ResourceUnavailable.FunctionNotFound"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

func (*Client) DescribeHostsSetting 

func (c *Client) DescribeHostsSetting(request *DescribeHostsSettingRequest) (response *DescribeHostsSettingResponse, err error)

DescribeHostsSetting This API is used to query detailed domain name configuration.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
INVALIDPARAMETER = "InvalidParameter"
OPERATIONDENIED = "OperationDenied"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeHostsSettingWithContext 

func (c *Client) DescribeHostsSettingWithContext(ctx context.Context, request *DescribeHostsSettingRequest) (response *DescribeHostsSettingResponse, err error)

DescribeHostsSetting This API is used to query detailed domain name configuration.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
INVALIDPARAMETER = "InvalidParameter"
OPERATIONDENIED = "OperationDenied"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeIPRegion 

func (c *Client) DescribeIPRegion(request *DescribeIPRegionRequest) (response *DescribeIPRegionResponse, err error)

DescribeIPRegion This API is used to check if the IP is an EdgeOne IP.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"

func (*Client) DescribeIPRegionWithContext 

func (c *Client) DescribeIPRegionWithContext(ctx context.Context, request *DescribeIPRegionRequest) (response *DescribeIPRegionResponse, err error)

DescribeIPRegion This API is used to check if the IP is an EdgeOne IP.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"

func (*Client) DescribeIdentifications 

func (c *Client) DescribeIdentifications(request *DescribeIdentificationsRequest) (response *DescribeIdentificationsResponse, err error)

DescribeIdentifications This API is used to query the verification information of a site.

error code that may be returned: 

OPERATIONDENIED_DOMAININSHARECNAMEGROUP = "OperationDenied.DomainInShareCnameGroup"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_RESOURCELOCKEDTEMPORARY = "OperationDenied.ResourceLockedTemporary"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE = "ResourceUnavailable"

func (*Client) DescribeIdentificationsWithContext 

func (c *Client) DescribeIdentificationsWithContext(ctx context.Context, request *DescribeIdentificationsRequest) (response *DescribeIdentificationsResponse, err error)

DescribeIdentifications This API is used to query the verification information of a site.

error code that may be returned: 

OPERATIONDENIED_DOMAININSHARECNAMEGROUP = "OperationDenied.DomainInShareCnameGroup"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_RESOURCELOCKEDTEMPORARY = "OperationDenied.ResourceLockedTemporary"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE = "ResourceUnavailable"

func (*Client) DescribeL4Proxy 

func (c *Client) DescribeL4Proxy(request *DescribeL4ProxyRequest) (response *DescribeL4ProxyResponse, err error)

DescribeL4Proxy This API is used to query a Layer 4 proxy instance list.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeL4ProxyRules 

func (c *Client) DescribeL4ProxyRules(request *DescribeL4ProxyRulesRequest) (response *DescribeL4ProxyRulesResponse, err error)

DescribeL4ProxyRules This API is used to query the forwarding rule list under a Layer 4 proxy instance.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeL4ProxyRulesWithContext 

func (c *Client) DescribeL4ProxyRulesWithContext(ctx context.Context, request *DescribeL4ProxyRulesRequest) (response *DescribeL4ProxyRulesResponse, err error)

DescribeL4ProxyRules This API is used to query the forwarding rule list under a Layer 4 proxy instance.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeL4ProxyWithContext 

func (c *Client) DescribeL4ProxyWithContext(ctx context.Context, request *DescribeL4ProxyRequest) (response *DescribeL4ProxyResponse, err error)

DescribeL4Proxy This API is used to query a Layer 4 proxy instance list.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeLoadBalancerList 

func (c *Client) DescribeLoadBalancerList(request *DescribeLoadBalancerListRequest) (response *DescribeLoadBalancerListResponse, err error)

DescribeLoadBalancerList This API is used to query the LoadBalancer list. The load balancing feature is in beta test. If you need to use it, [contact us](https://intl.cloud.tencent.com/online?from_cn_redirect=1-service).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"

func (*Client) DescribeLoadBalancerListWithContext 

func (c *Client) DescribeLoadBalancerListWithContext(ctx context.Context, request *DescribeLoadBalancerListRequest) (response *DescribeLoadBalancerListResponse, err error)

DescribeLoadBalancerList This API is used to query the LoadBalancer list. The load balancing feature is in beta test. If you need to use it, [contact us](https://intl.cloud.tencent.com/online?from_cn_redirect=1-service).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"

func (*Client) DescribeOriginGroup 

func (c *Client) DescribeOriginGroup(request *DescribeOriginGroupRequest) (response *DescribeOriginGroupResponse, err error)

DescribeOriginGroup This API is used to obtain a list of origin groups.

error code that may be returned: 

UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeOriginGroupHealthStatus 

func (c *Client) DescribeOriginGroupHealthStatus(request *DescribeOriginGroupHealthStatusRequest) (response *DescribeOriginGroupHealthStatusResponse, err error)

DescribeOriginGroupHealthStatus This API is used to query the health status of origin server groups under a LoadBalancer. The load balancing feature is in beta test. If you need to use it, [contact us](https://intl.cloud.tencent.com/online?from_cn_redirect=1-service).

error code that may be returned: 

UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeOriginGroupHealthStatusWithContext 

func (c *Client) DescribeOriginGroupHealthStatusWithContext(ctx context.Context, request *DescribeOriginGroupHealthStatusRequest) (response *DescribeOriginGroupHealthStatusResponse, err error)

DescribeOriginGroupHealthStatus This API is used to query the health status of origin server groups under a LoadBalancer. The load balancing feature is in beta test. If you need to use it, [contact us](https://intl.cloud.tencent.com/online?from_cn_redirect=1-service).

error code that may be returned: 

UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeOriginGroupWithContext 

func (c *Client) DescribeOriginGroupWithContext(ctx context.Context, request *DescribeOriginGroupRequest) (response *DescribeOriginGroupResponse, err error)

DescribeOriginGroup This API is used to obtain a list of origin groups.

error code that may be returned: 

UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeOriginProtection 

func (c *Client) DescribeOriginProtection(request *DescribeOriginProtectionRequest) (response *DescribeOriginProtectionResponse, err error)

DescribeOriginProtection This API is used to query the origin protection configuration.

error code that may be returned: 

INTERNALERROR = "InternalError"
INVALIDPARAMETER = "InvalidParameter"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeOriginProtectionWithContext 

func (c *Client) DescribeOriginProtectionWithContext(ctx context.Context, request *DescribeOriginProtectionRequest) (response *DescribeOriginProtectionResponse, err error)

DescribeOriginProtection This API is used to query the origin protection configuration.

error code that may be returned: 

INTERNALERROR = "InternalError"
INVALIDPARAMETER = "InvalidParameter"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeOverviewL7Data 

func (c *Client) DescribeOverviewL7Data(request *DescribeOverviewL7DataRequest) (response *DescribeOverviewL7DataResponse, err error)

DescribeOverviewL7Data This API is used to query the time sequence traffic data of the monitoring category in L7. This API is to be discarded. Please use the API <a href="https://intl.cloud.tencent.com/document/product/1552/80648?from_cn_redirect=1">DescribeTimingL7AnalysisData</a>.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
INVALIDPARAMETER = "InvalidParameter"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
LIMITEXCEEDED_QUERYTIMELIMITEXCEEDED = "LimitExceeded.QueryTimeLimitExceeded"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DescribeOverviewL7DataWithContext 

func (c *Client) DescribeOverviewL7DataWithContext(ctx context.Context, request *DescribeOverviewL7DataRequest) (response *DescribeOverviewL7DataResponse, err error)

DescribeOverviewL7Data This API is used to query the time sequence traffic data of the monitoring category in L7. This API is to be discarded. Please use the API <a href="https://intl.cloud.tencent.com/document/product/1552/80648?from_cn_redirect=1">DescribeTimingL7AnalysisData</a>.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
INVALIDPARAMETER = "InvalidParameter"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
LIMITEXCEEDED_QUERYTIMELIMITEXCEEDED = "LimitExceeded.QueryTimeLimitExceeded"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DescribePrefetchTasks 

func (c *Client) DescribePrefetchTasks(request *DescribePrefetchTasksRequest) (response *DescribePrefetchTasksResponse, err error)

DescribePrefetchTasks DescribePrefetchTasks is used to query the submission history and execution progress of preheating tasks. This interface can be used to query the tasks submitted by the CreatePrefetchTasks interface.

error code that may be returned: 

INTERNALERROR = "InternalError"
INVALIDPARAMETER_PARAMETERERROR = "InvalidParameter.ParameterError"
OPERATIONDENIED = "OperationDenied"
UNAUTHORIZEDOPERATION_DOMAINEMPTY = "UnauthorizedOperation.DomainEmpty"

func (*Client) DescribePrefetchTasksWithContext 

func (c *Client) DescribePrefetchTasksWithContext(ctx context.Context, request *DescribePrefetchTasksRequest) (response *DescribePrefetchTasksResponse, err error)

DescribePrefetchTasks DescribePrefetchTasks is used to query the submission history and execution progress of preheating tasks. This interface can be used to query the tasks submitted by the CreatePrefetchTasks interface.

error code that may be returned: 

INTERNALERROR = "InternalError"
INVALIDPARAMETER_PARAMETERERROR = "InvalidParameter.ParameterError"
OPERATIONDENIED = "OperationDenied"
UNAUTHORIZEDOPERATION_DOMAINEMPTY = "UnauthorizedOperation.DomainEmpty"

func (*Client) DescribePurgeTasks 

func (c *Client) DescribePurgeTasks(request *DescribePurgeTasksRequest) (response *DescribePurgeTasksResponse, err error)

DescribePurgeTasks DescribePurgeTasks is used to query the submitted URL refreshing and directory refreshing records and execution progress. This interface can be used to query the tasks submitted by the CreatePurgeTasks API.

error code that may be returned: 

INTERNALERROR = "InternalError"
INVALIDPARAMETER_PARAMETERERROR = "InvalidParameter.ParameterError"
OPERATIONDENIED = "OperationDenied"

func (*Client) DescribePurgeTasksWithContext 

func (c *Client) DescribePurgeTasksWithContext(ctx context.Context, request *DescribePurgeTasksRequest) (response *DescribePurgeTasksResponse, err error)

DescribePurgeTasks DescribePurgeTasks is used to query the submitted URL refreshing and directory refreshing records and execution progress. This interface can be used to query the tasks submitted by the CreatePurgeTasks API.

error code that may be returned: 

INTERNALERROR = "InternalError"
INVALIDPARAMETER_PARAMETERERROR = "InvalidParameter.ParameterError"
OPERATIONDENIED = "OperationDenied"

func (*Client) DescribeRealtimeLogDeliveryTasks 

func (c *Client) DescribeRealtimeLogDeliveryTasks(request *DescribeRealtimeLogDeliveryTasksRequest) (response *DescribeRealtimeLogDeliveryTasksResponse, err error)

DescribeRealtimeLogDeliveryTasks This API is used to query the real-time log delivery task list.

error code that may be returned: 

UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DescribeRealtimeLogDeliveryTasksWithContext 

func (c *Client) DescribeRealtimeLogDeliveryTasksWithContext(ctx context.Context, request *DescribeRealtimeLogDeliveryTasksRequest) (response *DescribeRealtimeLogDeliveryTasksResponse, err error)

DescribeRealtimeLogDeliveryTasks This API is used to query the real-time log delivery task list.

error code that may be returned: 

UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DescribeRules 

func (c *Client) DescribeRules(request *DescribeRulesRequest) (response *DescribeRulesResponse, err error)

DescribeRules This API is used to query the rules in the rule engine.

error code that may be returned: 

INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeRulesSetting 

func (c *Client) DescribeRulesSetting(request *DescribeRulesSettingRequest) (response *DescribeRulesSettingResponse, err error)

DescribeRulesSetting This API is used to return the list of the settings of the rule engine that can be used for request match and their detailed recommended configuration information.

error code that may be returned: 

INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeRulesSettingWithContext 

func (c *Client) DescribeRulesSettingWithContext(ctx context.Context, request *DescribeRulesSettingRequest) (response *DescribeRulesSettingResponse, err error)

DescribeRulesSetting This API is used to return the list of the settings of the rule engine that can be used for request match and their detailed recommended configuration information.

error code that may be returned: 

INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeRulesWithContext 

func (c *Client) DescribeRulesWithContext(ctx context.Context, request *DescribeRulesRequest) (response *DescribeRulesResponse, err error)

DescribeRules This API is used to query the rules in the rule engine.

error code that may be returned: 

INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeSecurityIPGroup 

func (c *Client) DescribeSecurityIPGroup(request *DescribeSecurityIPGroupRequest) (response *DescribeSecurityIPGroupResponse, err error)

DescribeSecurityIPGroup This API is used to query the configuration information of a security IP group, including the ID, name, and content of the security IP group.

error code that may be returned: 

INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeSecurityIPGroupInfo 

func (c *Client) DescribeSecurityIPGroupInfo(request *DescribeSecurityIPGroupInfoRequest) (response *DescribeSecurityIPGroupInfoResponse, err error)

DescribeSecurityIPGroupInfo The API is deprecated and will be discontinued on June 30, 2024. Please use the API [DescribeSecurityIPGroup

](https://intl.cloud.tencent.com/document/product/1552/105866?from_cn_redirect=1).

This API is used to query the configuration information of an IP group, including the IP group name, IP group content, and the site the IP group belongs to.

error code that may be returned: 

INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeSecurityIPGroupInfoWithContext 

func (c *Client) DescribeSecurityIPGroupInfoWithContext(ctx context.Context, request *DescribeSecurityIPGroupInfoRequest) (response *DescribeSecurityIPGroupInfoResponse, err error)

DescribeSecurityIPGroupInfo The API is deprecated and will be discontinued on June 30, 2024. Please use the API [DescribeSecurityIPGroup

](https://intl.cloud.tencent.com/document/product/1552/105866?from_cn_redirect=1).

This API is used to query the configuration information of an IP group, including the IP group name, IP group content, and the site the IP group belongs to.

error code that may be returned: 

INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeSecurityIPGroupWithContext 

func (c *Client) DescribeSecurityIPGroupWithContext(ctx context.Context, request *DescribeSecurityIPGroupRequest) (response *DescribeSecurityIPGroupResponse, err error)

DescribeSecurityIPGroup This API is used to query the configuration information of a security IP group, including the ID, name, and content of the security IP group.

error code that may be returned: 

INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeSecurityTemplateBindings 

func (c *Client) DescribeSecurityTemplateBindings(request *DescribeSecurityTemplateBindingsRequest) (response *DescribeSecurityTemplateBindingsResponse, err error)

DescribeSecurityTemplateBindings This API is used to query bindings of a policy template.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeSecurityTemplateBindingsWithContext 

func (c *Client) DescribeSecurityTemplateBindingsWithContext(ctx context.Context, request *DescribeSecurityTemplateBindingsRequest) (response *DescribeSecurityTemplateBindingsResponse, err error)

DescribeSecurityTemplateBindings This API is used to query bindings of a policy template.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeTimingL4Data 

func (c *Client) DescribeTimingL4Data(request *DescribeTimingL4DataRequest) (response *DescribeTimingL4DataResponse, err error)

DescribeTimingL4Data This API is used to query the list of L4 traffic data recorded over time.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
LIMITEXCEEDED = "LimitExceeded"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DescribeTimingL4DataWithContext 

func (c *Client) DescribeTimingL4DataWithContext(ctx context.Context, request *DescribeTimingL4DataRequest) (response *DescribeTimingL4DataResponse, err error)

DescribeTimingL4Data This API is used to query the list of L4 traffic data recorded over time.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
LIMITEXCEEDED = "LimitExceeded"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DescribeTimingL7AnalysisData 

func (c *Client) DescribeTimingL7AnalysisData(request *DescribeTimingL7AnalysisDataRequest) (response *DescribeTimingL7AnalysisDataResponse, err error)

DescribeTimingL7AnalysisData This API is used to query the time series data of the L7 domain name. Note that there is a delay of about 10 minutes for this API. It is recommended to pull data from 10 minutes before the current time.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INVALIDPARAMETER = "InvalidParameter"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
LIMITEXCEEDED = "LimitExceeded"
LIMITEXCEEDED_QUERYTIMELIMITEXCEEDED = "LimitExceeded.QueryTimeLimitExceeded"
OPERATIONDENIED = "OperationDenied"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DescribeTimingL7AnalysisDataWithContext 

func (c *Client) DescribeTimingL7AnalysisDataWithContext(ctx context.Context, request *DescribeTimingL7AnalysisDataRequest) (response *DescribeTimingL7AnalysisDataResponse, err error)

DescribeTimingL7AnalysisData This API is used to query the time series data of the L7 domain name. Note that there is a delay of about 10 minutes for this API. It is recommended to pull data from 10 minutes before the current time.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INVALIDPARAMETER = "InvalidParameter"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
LIMITEXCEEDED = "LimitExceeded"
LIMITEXCEEDED_QUERYTIMELIMITEXCEEDED = "LimitExceeded.QueryTimeLimitExceeded"
OPERATIONDENIED = "OperationDenied"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DescribeTimingL7CacheData 

func (c *Client) DescribeTimingL7CacheData(request *DescribeTimingL7CacheDataRequest) (response *DescribeTimingL7CacheDataResponse, err error)

DescribeTimingL7CacheData This API is used to query the time series traffic data of the L7 cache analysis. It will be deprecated. Use the <a href="https://intl.cloud.tencent.com/document/product/1552/80648?from_cn_redirect=1">DescribeTimingL7AnalysisData</a> API instead.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
LIMITEXCEEDED = "LimitExceeded"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DescribeTimingL7CacheDataWithContext 

func (c *Client) DescribeTimingL7CacheDataWithContext(ctx context.Context, request *DescribeTimingL7CacheDataRequest) (response *DescribeTimingL7CacheDataResponse, err error)

DescribeTimingL7CacheData This API is used to query the time series traffic data of the L7 cache analysis. It will be deprecated. Use the <a href="https://intl.cloud.tencent.com/document/product/1552/80648?from_cn_redirect=1">DescribeTimingL7AnalysisData</a> API instead.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
LIMITEXCEEDED = "LimitExceeded"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DescribeTopL7AnalysisData 

func (c *Client) DescribeTopL7AnalysisData(request *DescribeTopL7AnalysisDataRequest) (response *DescribeTopL7AnalysisDataResponse, err error)

DescribeTopL7AnalysisData This API is used to query the top N data of the L7 domain name by a specified dimension. Note that there is a delay of about 10 minutes for this API. It is recommended to pull data from 10 minutes before the current time.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INVALIDPARAMETER = "InvalidParameter"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
LIMITEXCEEDED = "LimitExceeded"
LIMITEXCEEDED_QUERYTIMELIMITEXCEEDED = "LimitExceeded.QueryTimeLimitExceeded"
OPERATIONDENIED = "OperationDenied"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"

func (*Client) DescribeTopL7AnalysisDataWithContext 

func (c *Client) DescribeTopL7AnalysisDataWithContext(ctx context.Context, request *DescribeTopL7AnalysisDataRequest) (response *DescribeTopL7AnalysisDataResponse, err error)

DescribeTopL7AnalysisData This API is used to query the top N data of the L7 domain name by a specified dimension. Note that there is a delay of about 10 minutes for this API. It is recommended to pull data from 10 minutes before the current time.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INVALIDPARAMETER = "InvalidParameter"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
LIMITEXCEEDED = "LimitExceeded"
LIMITEXCEEDED_QUERYTIMELIMITEXCEEDED = "LimitExceeded.QueryTimeLimitExceeded"
OPERATIONDENIED = "OperationDenied"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"

func (*Client) DescribeTopL7CacheData 

func (c *Client) DescribeTopL7CacheData(request *DescribeTopL7CacheDataRequest) (response *DescribeTopL7CacheDataResponse, err error)

DescribeTopL7CacheData This API is used to query the top N data of the L7 cache analysis. It will be deprecated. Use the <a href="https://intl.cloud.tencent.com/document/product/1552/80646?from_cn_redirect=1"> DescribeTopL7AnalysisData</a> API instead.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
LIMITEXCEEDED_QUERYTIMELIMITEXCEEDED = "LimitExceeded.QueryTimeLimitExceeded"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DescribeTopL7CacheDataWithContext 

func (c *Client) DescribeTopL7CacheDataWithContext(ctx context.Context, request *DescribeTopL7CacheDataRequest) (response *DescribeTopL7CacheDataResponse, err error)

DescribeTopL7CacheData This API is used to query the top N data of the L7 cache analysis. It will be deprecated. Use the <a href="https://intl.cloud.tencent.com/document/product/1552/80646?from_cn_redirect=1"> DescribeTopL7AnalysisData</a> API instead.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
LIMITEXCEEDED_QUERYTIMELIMITEXCEEDED = "LimitExceeded.QueryTimeLimitExceeded"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DescribeZoneSetting 

func (c *Client) DescribeZoneSetting(request *DescribeZoneSettingRequest) (response *DescribeZoneSettingResponse, err error)

DescribeZoneSetting This API is used to query the site configuration.

error code that may be returned: 

INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_SETTINGINVALIDPARAM = "InvalidParameter.SettingInvalidParam"
INVALIDPARAMETER_ZONENOTFOUND = "InvalidParameter.ZoneNotFound"
OPERATIONDENIED = "OperationDenied"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeZoneSettingWithContext 

func (c *Client) DescribeZoneSettingWithContext(ctx context.Context, request *DescribeZoneSettingRequest) (response *DescribeZoneSettingResponse, err error)

DescribeZoneSetting This API is used to query the site configuration.

error code that may be returned: 

INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_SETTINGINVALIDPARAM = "InvalidParameter.SettingInvalidParam"
INVALIDPARAMETER_ZONENOTFOUND = "InvalidParameter.ZoneNotFound"
OPERATIONDENIED = "OperationDenied"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeZones 

func (c *Client) DescribeZones(request *DescribeZonesRequest) (response *DescribeZonesResponse, err error)

DescribeZones This API is used to query the information of sites that you have access to. You can filter sites based on different query criteria.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
OPERATIONDENIED = "OperationDenied"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DescribeZonesWithContext 

func (c *Client) DescribeZonesWithContext(ctx context.Context, request *DescribeZonesRequest) (response *DescribeZonesResponse, err error)

DescribeZones This API is used to query the information of sites that you have access to. You can filter sites based on different query criteria.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
OPERATIONDENIED = "OperationDenied"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) DestroyPlan 

func (c *Client) DestroyPlan(request *DestroyPlanRequest) (response *DestroyPlanResponse, err error)

DestroyPlan To stop billing for your EdgeOne plan, you can use this interface to terminate the billing plan.

> Terminating a billing plan requires the following conditions:

  1. The plan has expired (except for the Enterprise Edition Plan);

  2. All sites under the plan have been either shut down or deleted.

> The site status can be queried through the [Query Site List](https://intl.cloud.tencent.com/document/product/1552/80713?from_cn_redirect=1) interface.

A site can be deactivated by switching the site to a closed status through the [Switch Site Status](https://intl.cloud.tencent.com/document/product/1552/80707?from_cn_redirect=1) interface.

A site can be deleted by using the [Delete Site](https://intl.cloud.tencent.com/document/product/1552/80717?from_cn_redirect=1) interface.

error code that may be returned: 

INVALIDPARAMETER_PLANNOTFOUND = "InvalidParameter.PlanNotFound"
OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"

func (*Client) DestroyPlanWithContext 

func (c *Client) DestroyPlanWithContext(ctx context.Context, request *DestroyPlanRequest) (response *DestroyPlanResponse, err error)

DestroyPlan To stop billing for your EdgeOne plan, you can use this interface to terminate the billing plan.

> Terminating a billing plan requires the following conditions:

  1. The plan has expired (except for the Enterprise Edition Plan);

  2. All sites under the plan have been either shut down or deleted.

> The site status can be queried through the [Query Site List](https://intl.cloud.tencent.com/document/product/1552/80713?from_cn_redirect=1) interface.

A site can be deactivated by switching the site to a closed status through the [Switch Site Status](https://intl.cloud.tencent.com/document/product/1552/80707?from_cn_redirect=1) interface.

A site can be deleted by using the [Delete Site](https://intl.cloud.tencent.com/document/product/1552/80717?from_cn_redirect=1) interface.

error code that may be returned: 

INVALIDPARAMETER_PLANNOTFOUND = "InvalidParameter.PlanNotFound"
OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"

func (*Client) DownloadL4Logs 

func (c *Client) DownloadL4Logs(request *DownloadL4LogsRequest) (response *DownloadL4LogsResponse, err error)

DownloadL4Logs This API is used to download L4 logs.

error code that may be returned: 

RESOURCEUNAVAILABLE = "ResourceUnavailable"

func (*Client) DownloadL4LogsWithContext 

func (c *Client) DownloadL4LogsWithContext(ctx context.Context, request *DownloadL4LogsRequest) (response *DownloadL4LogsResponse, err error)

DownloadL4Logs This API is used to download L4 logs.

error code that may be returned: 

RESOURCEUNAVAILABLE = "ResourceUnavailable"

func (*Client) DownloadL7Logs 

func (c *Client) DownloadL7Logs(request *DownloadL7LogsRequest) (response *DownloadL7LogsResponse, err error)

DownloadL7Logs This API is used to download L7 logs.

error code that may be returned: 

OPERATIONDENIED = "OperationDenied"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) DownloadL7LogsWithContext 

func (c *Client) DownloadL7LogsWithContext(ctx context.Context, request *DownloadL7LogsRequest) (response *DownloadL7LogsResponse, err error)

DownloadL7Logs This API is used to download L7 logs.

error code that may be returned: 

OPERATIONDENIED = "OperationDenied"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) HandleFunctionRuntimeEnvironment 

func (c *Client) HandleFunctionRuntimeEnvironment(request *HandleFunctionRuntimeEnvironmentRequest) (response *HandleFunctionRuntimeEnvironmentResponse, err error)

HandleFunctionRuntimeEnvironment This API is used to operate the runtime environment of an edge function. It supports related settings for environment variables.

After the environment variables are set, they can be used in the function code. For details, see [Edge Functions Referencing Environment Variables](https://intl.cloud.tencent.com/document/product/1552/109151?from_cn_redirect=1#0151fd9a-8b0e-407b-ae37-54553a60ded6).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_FUNCTIONDEPLOYING = "FailedOperation.FunctionDeploying"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_LENGTHEXCEEDSLIMIT = "InvalidParameter.LengthExceedsLimit"
RESOURCEUNAVAILABLE_FUNCTIONNOTFOUND = "ResourceUnavailable.FunctionNotFound"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

func (*Client) HandleFunctionRuntimeEnvironmentWithContext 

func (c *Client) HandleFunctionRuntimeEnvironmentWithContext(ctx context.Context, request *HandleFunctionRuntimeEnvironmentRequest) (response *HandleFunctionRuntimeEnvironmentResponse, err error)

HandleFunctionRuntimeEnvironment This API is used to operate the runtime environment of an edge function. It supports related settings for environment variables.

After the environment variables are set, they can be used in the function code. For details, see [Edge Functions Referencing Environment Variables](https://intl.cloud.tencent.com/document/product/1552/109151?from_cn_redirect=1#0151fd9a-8b0e-407b-ae37-54553a60ded6).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_FUNCTIONDEPLOYING = "FailedOperation.FunctionDeploying"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_LENGTHEXCEEDSLIMIT = "InvalidParameter.LengthExceedsLimit"
RESOURCEUNAVAILABLE_FUNCTIONNOTFOUND = "ResourceUnavailable.FunctionNotFound"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

func (*Client) IdentifyZone 

func (c *Client) IdentifyZone(request *IdentifyZoneRequest) (response *IdentifyZoneResponse, err error)

IdentifyZone This API is used to verify ownership of the site.

error code that may be returned: 

OPERATIONDENIED = "OperationDenied"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) IdentifyZoneWithContext 

func (c *Client) IdentifyZoneWithContext(ctx context.Context, request *IdentifyZoneRequest) (response *IdentifyZoneResponse, err error)

IdentifyZone This API is used to verify ownership of the site.

error code that may be returned: 

OPERATIONDENIED = "OperationDenied"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) IncreasePlanQuota 

func (c *Client) IncreasePlanQuota(request *IncreasePlanQuotaRequest) (response *IncreasePlanQuotaResponse, err error)

IncreasePlanQuota When the number of sites bound to your plan, the number of rules under "Web Protection - Custom Rules - Precision Matching Policy", or the number of rules under "Web Protection - Rate Limiting - Precision Rate Limiting Module" reaches the plan's quota, you can use this interface to purchase additional quotas.

> This interface only supports the Enterprise Edition Plan.

error code that may be returned: 

FAILEDOPERATION_INSUFFICIENTACCOUNTBALANCE = "FailedOperation.InsufficientAccountBalance"
INVALIDPARAMETER_INVALIDQUOTANUMBER = "InvalidParameter.InvalidQuotaNumber"
INVALIDPARAMETER_INVALIDQUOTATYPE = "InvalidParameter.InvalidQuotaType"
OPERATIONDENIED_PLANHASBEENISOLATED = "OperationDenied.PlanHasBeenIsolated"
OPERATIONDENIED_PLANINCREASEPLANQUOTAUNSUPPORTED = "OperationDenied.PlanIncreasePlanQuotaUnsupported"
OPERATIONDENIED_RESOURCEHASBEENLOCKED = "OperationDenied.ResourceHasBeenLocked"

func (*Client) IncreasePlanQuotaWithContext 

func (c *Client) IncreasePlanQuotaWithContext(ctx context.Context, request *IncreasePlanQuotaRequest) (response *IncreasePlanQuotaResponse, err error)

IncreasePlanQuota When the number of sites bound to your plan, the number of rules under "Web Protection - Custom Rules - Precision Matching Policy", or the number of rules under "Web Protection - Rate Limiting - Precision Rate Limiting Module" reaches the plan's quota, you can use this interface to purchase additional quotas.

> This interface only supports the Enterprise Edition Plan.

error code that may be returned: 

FAILEDOPERATION_INSUFFICIENTACCOUNTBALANCE = "FailedOperation.InsufficientAccountBalance"
INVALIDPARAMETER_INVALIDQUOTANUMBER = "InvalidParameter.InvalidQuotaNumber"
INVALIDPARAMETER_INVALIDQUOTATYPE = "InvalidParameter.InvalidQuotaType"
OPERATIONDENIED_PLANHASBEENISOLATED = "OperationDenied.PlanHasBeenIsolated"
OPERATIONDENIED_PLANINCREASEPLANQUOTAUNSUPPORTED = "OperationDenied.PlanIncreasePlanQuotaUnsupported"
OPERATIONDENIED_RESOURCEHASBEENLOCKED = "OperationDenied.ResourceHasBeenLocked"

func (*Client) ModifyAccelerationDomain 

func (c *Client) ModifyAccelerationDomain(request *ModifyAccelerationDomainRequest) (response *ModifyAccelerationDomainResponse, err error)

ModifyAccelerationDomain This API is used to modify an accelerated domain name.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_CONFLICTHOSTORIGIN = "InvalidParameter.ConflictHostOrigin"
INVALIDPARAMETER_INVALIDAWSREGION = "InvalidParameter.InvalidAwsRegion"
INVALIDPARAMETER_INVALIDAWSSECRETKEY = "InvalidParameter.InvalidAwsSecretKey"
INVALIDPARAMETER_INVALIDCLIENTIPORIGIN = "InvalidParameter.InvalidClientIpOrigin"
INVALIDPARAMETER_INVALIDHTTPS = "InvalidParameter.InvalidHttps"
INVALIDPARAMETER_INVALIDORIGIN = "InvalidParameter.InvalidOrigin"
INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_INVALIDPRIVATEACCESSPARAMS = "InvalidParameter.InvalidPrivateAccessParams"
INVALIDPARAMETER_INVALIDRANGEORIGINPULL = "InvalidParameter.InvalidRangeOriginPull"
INVALIDPARAMETER_INVALIDSTANDARDDEBUGCLIENTIP = "InvalidParameter.InvalidStandardDebugClientIp"
INVALIDPARAMETER_INVALIDWEBSOCKETTIMEOUT = "InvalidParameter.InvalidWebSocketTimeout"
INVALIDPARAMETER_ORIGINISINNERIP = "InvalidParameter.OriginIsInnerIp"
INVALIDPARAMETER_SPACENOTBINDORIGIN = "InvalidParameter.SpaceNotBindOrigin"
INVALIDPARAMETER_ZONEISGRAYPUBLISHING = "InvalidParameter.ZoneIsGrayPublishing"
INVALIDPARAMETERVALUE_CONFLICTRECORD = "InvalidParameterValue.ConflictRecord"
INVALIDPARAMETERVALUE_DOMAINNOTMATCHZONE = "InvalidParameterValue.DomainNotMatchZone"
INVALIDPARAMETERVALUE_INVALIDDOMAINSTATUS = "InvalidParameterValue.InvalidDomainStatus"
OPERATIONDENIED_DOMAINNOICP = "OperationDenied.DomainNoICP"
OPERATIONDENIED_RESOURCELOCKEDTEMPORARY = "OperationDenied.ResourceLockedTemporary"
OPERATIONDENIED_VERSIONCONTROLISGRAYING = "OperationDenied.VersionControlIsGraying"
RESOURCEINUSE = "ResourceInUse"
RESOURCEINUSE_DNSRECORD = "ResourceInUse.DnsRecord"
RESOURCEUNAVAILABLE_DOMAINNOTFOUND = "ResourceUnavailable.DomainNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"

func (*Client) ModifyAccelerationDomainStatuses 

func (c *Client) ModifyAccelerationDomainStatuses(request *ModifyAccelerationDomainStatusesRequest) (response *ModifyAccelerationDomainStatusesResponse, err error)

ModifyAccelerationDomainStatuses This API is used to batch modify the status of accelerated domains.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMVALUE = "InvalidParameter.ErrInvalidActionParamValue"
INVALIDPARAMETER_INVALIDERRORPAGE = "InvalidParameter.InvalidErrorPage"
INVALIDPARAMETER_INVALIDSERVERNAME = "InvalidParameter.InvalidServerName"
INVALIDPARAMETER_ZONEISGRAYPUBLISHING = "InvalidParameter.ZoneIsGrayPublishing"
INVALIDPARAMETERVALUE_DOMAINNOTMATCHZONE = "InvalidParameterValue.DomainNotMatchZone"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_RESOURCELOCKEDTEMPORARY = "OperationDenied.ResourceLockedTemporary"
OPERATIONDENIED_VERSIONCONTROLISGRAYING = "OperationDenied.VersionControlIsGraying"
OPERATIONDENIED_VERSIONCONTROLLOCKED = "OperationDenied.VersionControlLocked"
RESOURCEINUSE = "ResourceInUse"
RESOURCEUNAVAILABLE_DOMAINNOTFOUND = "ResourceUnavailable.DomainNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) ModifyAccelerationDomainStatusesWithContext 

func (c *Client) ModifyAccelerationDomainStatusesWithContext(ctx context.Context, request *ModifyAccelerationDomainStatusesRequest) (response *ModifyAccelerationDomainStatusesResponse, err error)

ModifyAccelerationDomainStatuses This API is used to batch modify the status of accelerated domains.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMVALUE = "InvalidParameter.ErrInvalidActionParamValue"
INVALIDPARAMETER_INVALIDERRORPAGE = "InvalidParameter.InvalidErrorPage"
INVALIDPARAMETER_INVALIDSERVERNAME = "InvalidParameter.InvalidServerName"
INVALIDPARAMETER_ZONEISGRAYPUBLISHING = "InvalidParameter.ZoneIsGrayPublishing"
INVALIDPARAMETERVALUE_DOMAINNOTMATCHZONE = "InvalidParameterValue.DomainNotMatchZone"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_RESOURCELOCKEDTEMPORARY = "OperationDenied.ResourceLockedTemporary"
OPERATIONDENIED_VERSIONCONTROLISGRAYING = "OperationDenied.VersionControlIsGraying"
OPERATIONDENIED_VERSIONCONTROLLOCKED = "OperationDenied.VersionControlLocked"
RESOURCEINUSE = "ResourceInUse"
RESOURCEUNAVAILABLE_DOMAINNOTFOUND = "ResourceUnavailable.DomainNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) ModifyAccelerationDomainWithContext 

func (c *Client) ModifyAccelerationDomainWithContext(ctx context.Context, request *ModifyAccelerationDomainRequest) (response *ModifyAccelerationDomainResponse, err error)

ModifyAccelerationDomain This API is used to modify an accelerated domain name.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_CONFLICTHOSTORIGIN = "InvalidParameter.ConflictHostOrigin"
INVALIDPARAMETER_INVALIDAWSREGION = "InvalidParameter.InvalidAwsRegion"
INVALIDPARAMETER_INVALIDAWSSECRETKEY = "InvalidParameter.InvalidAwsSecretKey"
INVALIDPARAMETER_INVALIDCLIENTIPORIGIN = "InvalidParameter.InvalidClientIpOrigin"
INVALIDPARAMETER_INVALIDHTTPS = "InvalidParameter.InvalidHttps"
INVALIDPARAMETER_INVALIDORIGIN = "InvalidParameter.InvalidOrigin"
INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_INVALIDPRIVATEACCESSPARAMS = "InvalidParameter.InvalidPrivateAccessParams"
INVALIDPARAMETER_INVALIDRANGEORIGINPULL = "InvalidParameter.InvalidRangeOriginPull"
INVALIDPARAMETER_INVALIDSTANDARDDEBUGCLIENTIP = "InvalidParameter.InvalidStandardDebugClientIp"
INVALIDPARAMETER_INVALIDWEBSOCKETTIMEOUT = "InvalidParameter.InvalidWebSocketTimeout"
INVALIDPARAMETER_ORIGINISINNERIP = "InvalidParameter.OriginIsInnerIp"
INVALIDPARAMETER_SPACENOTBINDORIGIN = "InvalidParameter.SpaceNotBindOrigin"
INVALIDPARAMETER_ZONEISGRAYPUBLISHING = "InvalidParameter.ZoneIsGrayPublishing"
INVALIDPARAMETERVALUE_CONFLICTRECORD = "InvalidParameterValue.ConflictRecord"
INVALIDPARAMETERVALUE_DOMAINNOTMATCHZONE = "InvalidParameterValue.DomainNotMatchZone"
INVALIDPARAMETERVALUE_INVALIDDOMAINSTATUS = "InvalidParameterValue.InvalidDomainStatus"
OPERATIONDENIED_DOMAINNOICP = "OperationDenied.DomainNoICP"
OPERATIONDENIED_RESOURCELOCKEDTEMPORARY = "OperationDenied.ResourceLockedTemporary"
OPERATIONDENIED_VERSIONCONTROLISGRAYING = "OperationDenied.VersionControlIsGraying"
RESOURCEINUSE = "ResourceInUse"
RESOURCEINUSE_DNSRECORD = "ResourceInUse.DnsRecord"
RESOURCEUNAVAILABLE_DOMAINNOTFOUND = "ResourceUnavailable.DomainNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"

func (*Client) ModifyAliasDomain 

func (c *Client) ModifyAliasDomain(request *ModifyAliasDomainRequest) (response *ModifyAliasDomainResponse, err error)

ModifyAliasDomain This API is used to modify an alias domain name.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR = "InternalError"
INVALIDPARAMETER_CERTNOTMATCHDOMAIN = "InvalidParameter.CertNotMatchDomain"
OPERATIONDENIED = "OperationDenied"

func (*Client) ModifyAliasDomainStatus 

func (c *Client) ModifyAliasDomainStatus(request *ModifyAliasDomainStatusRequest) (response *ModifyAliasDomainStatusResponse, err error)

ModifyAliasDomainStatus This API is used to modify the status of an alias domain name.

error code that may be returned: 

INTERNALERROR = "InternalError"
OPERATIONDENIED = "OperationDenied"
RESOURCEINUSE = "ResourceInUse"

func (*Client) ModifyAliasDomainStatusWithContext 

func (c *Client) ModifyAliasDomainStatusWithContext(ctx context.Context, request *ModifyAliasDomainStatusRequest) (response *ModifyAliasDomainStatusResponse, err error)

ModifyAliasDomainStatus This API is used to modify the status of an alias domain name.

error code that may be returned: 

INTERNALERROR = "InternalError"
OPERATIONDENIED = "OperationDenied"
RESOURCEINUSE = "ResourceInUse"

func (*Client) ModifyAliasDomainWithContext 

func (c *Client) ModifyAliasDomainWithContext(ctx context.Context, request *ModifyAliasDomainRequest) (response *ModifyAliasDomainResponse, err error)

ModifyAliasDomain This API is used to modify an alias domain name.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INTERNALERROR = "InternalError"
INVALIDPARAMETER_CERTNOTMATCHDOMAIN = "InvalidParameter.CertNotMatchDomain"
OPERATIONDENIED = "OperationDenied"

func (*Client) ModifyApplicationProxy 

func (c *Client) ModifyApplicationProxy(request *ModifyApplicationProxyRequest) (response *ModifyApplicationProxyResponse, err error)

ModifyApplicationProxy This API is on an earlier version. If you want to call it, please switch to the latest version. For details, see [ModifyL4Proxy

] (https://intl.cloud.tencent.com/document/product/1552/103411?from_cn_redirect=1).

error code that may be returned: 

INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_L4LACKOFRESOURCES = "OperationDenied.L4LackOfResources"
OPERATIONDENIED_L4PROXYINBANNEDSTATUS = "OperationDenied.L4ProxyInBannedStatus"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) ModifyApplicationProxyRule 

func (c *Client) ModifyApplicationProxyRule(request *ModifyApplicationProxyRuleRequest) (response *ModifyApplicationProxyRuleResponse, err error)

ModifyApplicationProxyRule This API is on an earlier version. If you want to call it, please switch to the latest version. For details, see [ModifyL4ProxyRules] (https://intl.cloud.tencent.com/document/product/1552/103410?from_cn_redirect=1).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_PARAMETERERROR = "InvalidParameter.ParameterError"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_L4PROXYINBANNEDSTATUS = "OperationDenied.L4ProxyInBannedStatus"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) ModifyApplicationProxyRuleStatus 

func (c *Client) ModifyApplicationProxyRuleStatus(request *ModifyApplicationProxyRuleStatusRequest) (response *ModifyApplicationProxyRuleStatusResponse, err error)

ModifyApplicationProxyRuleStatus This API is on an earlier version. If you want to call it, please switch to the latest version. For details, see [ModifyL4ProxyRulesStatus

] (https://intl.cloud.tencent.com/document/product/1552/103409?from_cn_redirect=1).

error code that may be returned: 

OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_L4PROXYINBANNEDSTATUS = "OperationDenied.L4ProxyInBannedStatus"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) ModifyApplicationProxyRuleStatusWithContext 

func (c *Client) ModifyApplicationProxyRuleStatusWithContext(ctx context.Context, request *ModifyApplicationProxyRuleStatusRequest) (response *ModifyApplicationProxyRuleStatusResponse, err error)

ModifyApplicationProxyRuleStatus This API is on an earlier version. If you want to call it, please switch to the latest version. For details, see [ModifyL4ProxyRulesStatus

] (https://intl.cloud.tencent.com/document/product/1552/103409?from_cn_redirect=1).

error code that may be returned: 

OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_L4PROXYINBANNEDSTATUS = "OperationDenied.L4ProxyInBannedStatus"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) ModifyApplicationProxyRuleWithContext 

func (c *Client) ModifyApplicationProxyRuleWithContext(ctx context.Context, request *ModifyApplicationProxyRuleRequest) (response *ModifyApplicationProxyRuleResponse, err error)

ModifyApplicationProxyRule This API is on an earlier version. If you want to call it, please switch to the latest version. For details, see [ModifyL4ProxyRules] (https://intl.cloud.tencent.com/document/product/1552/103410?from_cn_redirect=1).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_PARAMETERERROR = "InvalidParameter.ParameterError"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_L4PROXYINBANNEDSTATUS = "OperationDenied.L4ProxyInBannedStatus"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) ModifyApplicationProxyStatus 

func (c *Client) ModifyApplicationProxyStatus(request *ModifyApplicationProxyStatusRequest) (response *ModifyApplicationProxyStatusResponse, err error)

ModifyApplicationProxyStatus This API is on an earlier version. If you want to call it, please switch to the latest version. For details, see [ModifyL4ProxyStatus] (https://intl.cloud.tencent.com/document/product/1552/103408?from_cn_redirect=1).

error code that may be returned: 

INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_L4PROXYINBANNEDSTATUS = "OperationDenied.L4ProxyInBannedStatus"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) ModifyApplicationProxyStatusWithContext 

func (c *Client) ModifyApplicationProxyStatusWithContext(ctx context.Context, request *ModifyApplicationProxyStatusRequest) (response *ModifyApplicationProxyStatusResponse, err error)

ModifyApplicationProxyStatus This API is on an earlier version. If you want to call it, please switch to the latest version. For details, see [ModifyL4ProxyStatus] (https://intl.cloud.tencent.com/document/product/1552/103408?from_cn_redirect=1).

error code that may be returned: 

INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_L4PROXYINBANNEDSTATUS = "OperationDenied.L4ProxyInBannedStatus"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) ModifyApplicationProxyWithContext 

func (c *Client) ModifyApplicationProxyWithContext(ctx context.Context, request *ModifyApplicationProxyRequest) (response *ModifyApplicationProxyResponse, err error)

ModifyApplicationProxy This API is on an earlier version. If you want to call it, please switch to the latest version. For details, see [ModifyL4Proxy

] (https://intl.cloud.tencent.com/document/product/1552/103411?from_cn_redirect=1).

error code that may be returned: 

INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_L4LACKOFRESOURCES = "OperationDenied.L4LackOfResources"
OPERATIONDENIED_L4PROXYINBANNEDSTATUS = "OperationDenied.L4ProxyInBannedStatus"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) ModifyCustomErrorPage 

func (c *Client) ModifyCustomErrorPage(request *ModifyCustomErrorPageRequest) (response *ModifyCustomErrorPageResponse, err error)

ModifyCustomErrorPage This API is used to modify a custom response page.

error code that may be returned: 

RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) ModifyCustomErrorPageWithContext 

func (c *Client) ModifyCustomErrorPageWithContext(ctx context.Context, request *ModifyCustomErrorPageRequest) (response *ModifyCustomErrorPageResponse, err error)

ModifyCustomErrorPage This API is used to modify a custom response page.

error code that may be returned: 

RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) ModifyFunction 

func (c *Client) ModifyFunction(request *ModifyFunctionRequest) (response *ModifyFunctionResponse, err error)

ModifyFunction This API is used to modify an edge function. It supports modifying the function content and description. The function will take effect immediately after modification and redeployment.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_FUNCTIONDEPLOYING = "FailedOperation.FunctionDeploying"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_BADCONTENT = "InvalidParameter.BadContent"
INVALIDPARAMETER_CONTENTEXCEEDSLIMIT = "InvalidParameter.ContentExceedsLimit"
INVALIDPARAMETER_LENGTHEXCEEDSLIMIT = "InvalidParameter.LengthExceedsLimit"
INVALIDPARAMETER_MODIFYPARAMETERSMISSING = "InvalidParameter.ModifyParametersMissing"
RESOURCEUNAVAILABLE_FUNCTIONNOTFOUND = "ResourceUnavailable.FunctionNotFound"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

func (*Client) ModifyFunctionRule 

func (c *Client) ModifyFunctionRule(request *ModifyFunctionRuleRequest) (response *ModifyFunctionRuleResponse, err error)

ModifyFunctionRule This API is used to modify a trigger rule for an edge function. It supports modifying rule conditions, execution functions, and description.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_RULEOPERATIONCONFLICT = "FailedOperation.RuleOperationConflict"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_DUPLICATERULE = "InvalidParameter.DuplicateRule"
INVALIDPARAMETER_INVALIDCONDITIONS = "InvalidParameter.InvalidConditions"
INVALIDPARAMETER_MODIFYPARAMETERSMISSING = "InvalidParameter.ModifyParametersMissing"
RESOURCEUNAVAILABLE_FUNCTIONNOTFOUND = "ResourceUnavailable.FunctionNotFound"
RESOURCEUNAVAILABLE_RULENOTFOUND = "ResourceUnavailable.RuleNotFound"

func (*Client) ModifyFunctionRulePriority 

func (c *Client) ModifyFunctionRulePriority(request *ModifyFunctionRulePriorityRequest) (response *ModifyFunctionRulePriorityResponse, err error)

ModifyFunctionRulePriority This API is used to modify the priority of trigger rules for an edge function.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_RULEOPERATIONCONFLICT = "FailedOperation.RuleOperationConflict"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

func (*Client) ModifyFunctionRulePriorityWithContext 

func (c *Client) ModifyFunctionRulePriorityWithContext(ctx context.Context, request *ModifyFunctionRulePriorityRequest) (response *ModifyFunctionRulePriorityResponse, err error)

ModifyFunctionRulePriority This API is used to modify the priority of trigger rules for an edge function.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_RULEOPERATIONCONFLICT = "FailedOperation.RuleOperationConflict"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

func (*Client) ModifyFunctionRuleWithContext 

func (c *Client) ModifyFunctionRuleWithContext(ctx context.Context, request *ModifyFunctionRuleRequest) (response *ModifyFunctionRuleResponse, err error)

ModifyFunctionRule This API is used to modify a trigger rule for an edge function. It supports modifying rule conditions, execution functions, and description.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_RULEOPERATIONCONFLICT = "FailedOperation.RuleOperationConflict"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_DUPLICATERULE = "InvalidParameter.DuplicateRule"
INVALIDPARAMETER_INVALIDCONDITIONS = "InvalidParameter.InvalidConditions"
INVALIDPARAMETER_MODIFYPARAMETERSMISSING = "InvalidParameter.ModifyParametersMissing"
RESOURCEUNAVAILABLE_FUNCTIONNOTFOUND = "ResourceUnavailable.FunctionNotFound"
RESOURCEUNAVAILABLE_RULENOTFOUND = "ResourceUnavailable.RuleNotFound"

func (*Client) ModifyFunctionWithContext 

func (c *Client) ModifyFunctionWithContext(ctx context.Context, request *ModifyFunctionRequest) (response *ModifyFunctionResponse, err error)

ModifyFunction This API is used to modify an edge function. It supports modifying the function content and description. The function will take effect immediately after modification and redeployment.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_FUNCTIONDEPLOYING = "FailedOperation.FunctionDeploying"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_BADCONTENT = "InvalidParameter.BadContent"
INVALIDPARAMETER_CONTENTEXCEEDSLIMIT = "InvalidParameter.ContentExceedsLimit"
INVALIDPARAMETER_LENGTHEXCEEDSLIMIT = "InvalidParameter.LengthExceedsLimit"
INVALIDPARAMETER_MODIFYPARAMETERSMISSING = "InvalidParameter.ModifyParametersMissing"
RESOURCEUNAVAILABLE_FUNCTIONNOTFOUND = "ResourceUnavailable.FunctionNotFound"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"

func (*Client) ModifyHostsCertificate 

func (c *Client) ModifyHostsCertificate(request *ModifyHostsCertificateRequest) (response *ModifyHostsCertificateResponse, err error)

ModifyHostsCertificate This API is used to configure the certificate of a site. You can use your own certificate or [apply for a free certificate](https://intl.cloud.tencent.com/document/product/1552/90437?from_cn_redirect=1).

To use an external certificate, upload the certificate to [SSL Certificates Console](https://console.cloud.tencent.com/certoview) first, and then input the certificate ID in this API. For details, see [Deploying Own Certificates to EdgeOne Domains](https://intl.cloud.tencent.com/document/product/1552/88874?from_cn_redirect=1).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_CERTIFICATEHASEXPIRED = "FailedOperation.CertificateHasExpired"
FAILEDOPERATION_CERTIFICATENOTFOUND = "FailedOperation.CertificateNotFound"
FAILEDOPERATION_EDGECLIENTCERTIFICATEHASEXPIRED = "FailedOperation.EdgeClientCertificateHasExpired"
FAILEDOPERATION_INVALIDZONESTATUS = "FailedOperation.InvalidZoneStatus"
FAILEDOPERATION_MODIFYFAILED = "FailedOperation.ModifyFailed"
FAILEDOPERATION_UPSTREAMCLIENTCERTIFICATEHASEXPIRED = "FailedOperation.UpstreamClientCertificateHasExpired"
INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_GETROLEERROR = "InternalError.GetRoleError"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INTERNALERROR_UNKNOWERROR = "InternalError.UnknowError"
INVALIDPARAMETER_ACTIONINPROGRESS = "InvalidParameter.ActionInProgress"
INVALIDPARAMETER_ALIASDOMAINNOTSUPPORTKEYLESS = "InvalidParameter.AliasDomainNotSupportKeyless"
INVALIDPARAMETER_CERTNOTMATCHDOMAIN = "InvalidParameter.CertNotMatchDomain"
INVALIDPARAMETER_CERTTOEXPIRE = "InvalidParameter.CertToExpire"
INVALIDPARAMETER_CERTTOOSHORTKEYSIZE = "InvalidParameter.CertTooShortKeySize"
INVALIDPARAMETER_CERTIFICATECONFLICTWITHKEYLESSSERVER = "InvalidParameter.CertificateConflictWithKeylessServer"
INVALIDPARAMETER_CNAMEWILDHOSTNOTALLOWAPPLYCERTIFICATE = "InvalidParameter.CnameWildHostNotAllowApplyCertificate"
INVALIDPARAMETER_EDGECLIENTCERTCHECKERROR = "InvalidParameter.EdgeClientCertCheckError"
INVALIDPARAMETER_HOSTSTATUSNOTALLOWAPPLYCERTIFICATE = "InvalidParameter.HostStatusNotAllowApplyCertificate"
INVALIDPARAMETER_INVALIDCERTINFO = "InvalidParameter.InvalidCertInfo"
INVALIDPARAMETER_INVALIDHTTPSCERTINFO = "InvalidParameter.InvalidHttpsCertInfo"
INVALIDPARAMETER_INVALIDHTTPSTLSVERSION = "InvalidParameter.InvalidHttpsTlsVersion"
INVALIDPARAMETER_UPSTREAMCLIENTCERTCHECKERROR = "InvalidParameter.UpstreamClientCertCheckError"
INVALIDPARAMETER_ZONEISGRAYPUBLISHING = "InvalidParameter.ZoneIsGrayPublishing"
INVALIDPARAMETERVALUE_ALIASDOMAINNOTSUPPORTEDGEMTLS = "InvalidParameterValue.AliasDomainNotSupportEdgeMTLS"
INVALIDPARAMETERVALUE_ALIASDOMAINNOTSUPPORTUPSTREAMMTLS = "InvalidParameterValue.AliasDomainNotSupportUpstreamMTLS"
INVALIDPARAMETERVALUE_CERTIFICATEVERIFYCLIENTMUSTCA = "InvalidParameterValue.CertificateVerifyClientMustCa"
INVALIDPARAMETERVALUE_CERTIFICATEVERIFYCLIENTNEEDCERT = "InvalidParameterValue.CertificateVerifyClientNeedCert"
INVALIDPARAMETERVALUE_CERTIFICATEVERIFYUPSTREAMCLIENTMUSTRSAORECC = "InvalidParameterValue.CertificateVerifyUpstreamClientMustRSAorECC"
INVALIDPARAMETERVALUE_CERTIFICATEVERIFYUPSTREAMCLIENTMUSTSVR = "InvalidParameterValue.CertificateVerifyUpstreamClientMustSVR"
INVALIDPARAMETERVALUE_CERTIFICATEVERIFYUPSTREAMCLIENTNEEDCERT = "InvalidParameterValue.CertificateVerifyUpstreamClientNeedCert"
INVALIDPARAMETERVALUE_CLIENTCERTINFOQUOTALIMIT = "InvalidParameterValue.ClientCertInfoQuotaLimit"
INVALIDPARAMETERVALUE_INVALIDKEYLESSSERVERID = "InvalidParameterValue.InvalidKeylessServerId"
INVALIDPARAMETERVALUE_SERVERCERTINFONEEDCONTAINRSAORECC = "InvalidParameterValue.ServerCertInfoNeedContainRSAorECC"
INVALIDPARAMETERVALUE_SERVERCERTINFONEEDCONTAINSM2 = "InvalidParameterValue.ServerCertInfoNeedContainSM2"
INVALIDPARAMETERVALUE_UPSTREAMCLIENTCERTINFOQUOTALIMIT = "InvalidParameterValue.UpstreamClientCertInfoQuotaLimit"
LIMITEXCEEDED_RATELIMITEXCEEDED = "LimitExceeded.RateLimitExceeded"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_CERTIFICATEPRIVATEKEYISEMPTY = "OperationDenied.CertificatePrivateKeyIsEmpty"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_HOSTSCLIENTCERTIFICATEINCONSISTENCY = "OperationDenied.HostsClientCertificateInconsistency"
OPERATIONDENIED_HOSTSKEYLESSSERVERINCONSISTENCY = "OperationDenied.HostsKeylessServerInconsistency"
OPERATIONDENIED_HOSTSUPSTREAMCERTIFICATEINCONSISTENCY = "OperationDenied.HostsUpstreamCertificateInconsistency"
OPERATIONDENIED_KEYLESSCERTSWITCHTOFREECERTCONFLICT = "OperationDenied.KeylessCertSwitchToFreeCertConflict"
OPERATIONDENIED_KEYLESSMODECERTIFICATEPRIVATEKEYNEEDEMPTY = "OperationDenied.KeylessModeCertificatePrivateKeyNeedEmpty"
OPERATIONDENIED_NOTINKEYLESSWHITELIST = "OperationDenied.NotInKeylessWhiteList"
OPERATIONDENIED_NOTINUPSTREAMMTLSWHITELIST = "OperationDenied.NotInUpstreamMTLSWhiteList"
OPERATIONDENIED_UNSUPPORTTOCLOSEUPSTREAMMTLS = "OperationDenied.UnSupportToCloseUpstreamMTLS"
OPERATIONDENIED_USEUPSTREAMMTLSNEEDOPENHTTPS = "OperationDenied.UseUpstreamMTLSNeedOpenHttps"
OPERATIONDENIED_VERSIONCONTROLISGRAYING = "OperationDenied.VersionControlIsGraying"
RESOURCEINUSE = "ResourceInUse"
RESOURCEUNAVAILABLE_CERTNOTFOUND = "ResourceUnavailable.CertNotFound"
RESOURCEUNAVAILABLE_HOSTNOTFOUND = "ResourceUnavailable.HostNotFound"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) ModifyHostsCertificateWithContext 

func (c *Client) ModifyHostsCertificateWithContext(ctx context.Context, request *ModifyHostsCertificateRequest) (response *ModifyHostsCertificateResponse, err error)

ModifyHostsCertificate This API is used to configure the certificate of a site. You can use your own certificate or [apply for a free certificate](https://intl.cloud.tencent.com/document/product/1552/90437?from_cn_redirect=1).

To use an external certificate, upload the certificate to [SSL Certificates Console](https://console.cloud.tencent.com/certoview) first, and then input the certificate ID in this API. For details, see [Deploying Own Certificates to EdgeOne Domains](https://intl.cloud.tencent.com/document/product/1552/88874?from_cn_redirect=1).

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_CERTIFICATEHASEXPIRED = "FailedOperation.CertificateHasExpired"
FAILEDOPERATION_CERTIFICATENOTFOUND = "FailedOperation.CertificateNotFound"
FAILEDOPERATION_EDGECLIENTCERTIFICATEHASEXPIRED = "FailedOperation.EdgeClientCertificateHasExpired"
FAILEDOPERATION_INVALIDZONESTATUS = "FailedOperation.InvalidZoneStatus"
FAILEDOPERATION_MODIFYFAILED = "FailedOperation.ModifyFailed"
FAILEDOPERATION_UPSTREAMCLIENTCERTIFICATEHASEXPIRED = "FailedOperation.UpstreamClientCertificateHasExpired"
INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_GETROLEERROR = "InternalError.GetRoleError"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INTERNALERROR_UNKNOWERROR = "InternalError.UnknowError"
INVALIDPARAMETER_ACTIONINPROGRESS = "InvalidParameter.ActionInProgress"
INVALIDPARAMETER_ALIASDOMAINNOTSUPPORTKEYLESS = "InvalidParameter.AliasDomainNotSupportKeyless"
INVALIDPARAMETER_CERTNOTMATCHDOMAIN = "InvalidParameter.CertNotMatchDomain"
INVALIDPARAMETER_CERTTOEXPIRE = "InvalidParameter.CertToExpire"
INVALIDPARAMETER_CERTTOOSHORTKEYSIZE = "InvalidParameter.CertTooShortKeySize"
INVALIDPARAMETER_CERTIFICATECONFLICTWITHKEYLESSSERVER = "InvalidParameter.CertificateConflictWithKeylessServer"
INVALIDPARAMETER_CNAMEWILDHOSTNOTALLOWAPPLYCERTIFICATE = "InvalidParameter.CnameWildHostNotAllowApplyCertificate"
INVALIDPARAMETER_EDGECLIENTCERTCHECKERROR = "InvalidParameter.EdgeClientCertCheckError"
INVALIDPARAMETER_HOSTSTATUSNOTALLOWAPPLYCERTIFICATE = "InvalidParameter.HostStatusNotAllowApplyCertificate"
INVALIDPARAMETER_INVALIDCERTINFO = "InvalidParameter.InvalidCertInfo"
INVALIDPARAMETER_INVALIDHTTPSCERTINFO = "InvalidParameter.InvalidHttpsCertInfo"
INVALIDPARAMETER_INVALIDHTTPSTLSVERSION = "InvalidParameter.InvalidHttpsTlsVersion"
INVALIDPARAMETER_UPSTREAMCLIENTCERTCHECKERROR = "InvalidParameter.UpstreamClientCertCheckError"
INVALIDPARAMETER_ZONEISGRAYPUBLISHING = "InvalidParameter.ZoneIsGrayPublishing"
INVALIDPARAMETERVALUE_ALIASDOMAINNOTSUPPORTEDGEMTLS = "InvalidParameterValue.AliasDomainNotSupportEdgeMTLS"
INVALIDPARAMETERVALUE_ALIASDOMAINNOTSUPPORTUPSTREAMMTLS = "InvalidParameterValue.AliasDomainNotSupportUpstreamMTLS"
INVALIDPARAMETERVALUE_CERTIFICATEVERIFYCLIENTMUSTCA = "InvalidParameterValue.CertificateVerifyClientMustCa"
INVALIDPARAMETERVALUE_CERTIFICATEVERIFYCLIENTNEEDCERT = "InvalidParameterValue.CertificateVerifyClientNeedCert"
INVALIDPARAMETERVALUE_CERTIFICATEVERIFYUPSTREAMCLIENTMUSTRSAORECC = "InvalidParameterValue.CertificateVerifyUpstreamClientMustRSAorECC"
INVALIDPARAMETERVALUE_CERTIFICATEVERIFYUPSTREAMCLIENTMUSTSVR = "InvalidParameterValue.CertificateVerifyUpstreamClientMustSVR"
INVALIDPARAMETERVALUE_CERTIFICATEVERIFYUPSTREAMCLIENTNEEDCERT = "InvalidParameterValue.CertificateVerifyUpstreamClientNeedCert"
INVALIDPARAMETERVALUE_CLIENTCERTINFOQUOTALIMIT = "InvalidParameterValue.ClientCertInfoQuotaLimit"
INVALIDPARAMETERVALUE_INVALIDKEYLESSSERVERID = "InvalidParameterValue.InvalidKeylessServerId"
INVALIDPARAMETERVALUE_SERVERCERTINFONEEDCONTAINRSAORECC = "InvalidParameterValue.ServerCertInfoNeedContainRSAorECC"
INVALIDPARAMETERVALUE_SERVERCERTINFONEEDCONTAINSM2 = "InvalidParameterValue.ServerCertInfoNeedContainSM2"
INVALIDPARAMETERVALUE_UPSTREAMCLIENTCERTINFOQUOTALIMIT = "InvalidParameterValue.UpstreamClientCertInfoQuotaLimit"
LIMITEXCEEDED_RATELIMITEXCEEDED = "LimitExceeded.RateLimitExceeded"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_CERTIFICATEPRIVATEKEYISEMPTY = "OperationDenied.CertificatePrivateKeyIsEmpty"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_HOSTSCLIENTCERTIFICATEINCONSISTENCY = "OperationDenied.HostsClientCertificateInconsistency"
OPERATIONDENIED_HOSTSKEYLESSSERVERINCONSISTENCY = "OperationDenied.HostsKeylessServerInconsistency"
OPERATIONDENIED_HOSTSUPSTREAMCERTIFICATEINCONSISTENCY = "OperationDenied.HostsUpstreamCertificateInconsistency"
OPERATIONDENIED_KEYLESSCERTSWITCHTOFREECERTCONFLICT = "OperationDenied.KeylessCertSwitchToFreeCertConflict"
OPERATIONDENIED_KEYLESSMODECERTIFICATEPRIVATEKEYNEEDEMPTY = "OperationDenied.KeylessModeCertificatePrivateKeyNeedEmpty"
OPERATIONDENIED_NOTINKEYLESSWHITELIST = "OperationDenied.NotInKeylessWhiteList"
OPERATIONDENIED_NOTINUPSTREAMMTLSWHITELIST = "OperationDenied.NotInUpstreamMTLSWhiteList"
OPERATIONDENIED_UNSUPPORTTOCLOSEUPSTREAMMTLS = "OperationDenied.UnSupportToCloseUpstreamMTLS"
OPERATIONDENIED_USEUPSTREAMMTLSNEEDOPENHTTPS = "OperationDenied.UseUpstreamMTLSNeedOpenHttps"
OPERATIONDENIED_VERSIONCONTROLISGRAYING = "OperationDenied.VersionControlIsGraying"
RESOURCEINUSE = "ResourceInUse"
RESOURCEUNAVAILABLE_CERTNOTFOUND = "ResourceUnavailable.CertNotFound"
RESOURCEUNAVAILABLE_HOSTNOTFOUND = "ResourceUnavailable.HostNotFound"
RESOURCEUNAVAILABLE_ZONENOTFOUND = "ResourceUnavailable.ZoneNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) ModifyL4Proxy 

func (c *Client) ModifyL4Proxy(request *ModifyL4ProxyRequest) (response *ModifyL4ProxyResponse, err error)

ModifyL4Proxy This API is used to modify the configuration of a Layer 4 proxy instance.

error code that may be returned: 

OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ACCELERATEMAINLANDDISABLE = "OperationDenied.AccelerateMainlandDisable"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_L4LACKOFRESOURCES = "OperationDenied.L4LackOfResources"
OPERATIONDENIED_L4PROXYINOFFLINESTATUS = "OperationDenied.L4ProxyInOfflineStatus"
OPERATIONDENIED_L4PROXYINPROCESSSTATUS = "OperationDenied.L4ProxyInProcessStatus"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) ModifyL4ProxyRules 

func (c *Client) ModifyL4ProxyRules(request *ModifyL4ProxyRulesRequest) (response *ModifyL4ProxyRulesResponse, err error)

ModifyL4ProxyRules This API is used to modify Layer 4 proxy forwarding rules, supporting both individual and batch modification.

error code that may be returned: 

INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_PARAMETERERROR = "InvalidParameter.ParameterError"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_L4PROXYINBANNEDSTATUS = "OperationDenied.L4ProxyInBannedStatus"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) ModifyL4ProxyRulesStatus 

func (c *Client) ModifyL4ProxyRulesStatus(request *ModifyL4ProxyRulesStatusRequest) (response *ModifyL4ProxyRulesStatusResponse, err error)

ModifyL4ProxyRulesStatus This API is used to start or stop Layer 4 proxy forwarding rules, supporting both individual and batch operation.

error code that may be returned: 

OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_L4PROXYINBANNEDSTATUS = "OperationDenied.L4ProxyInBannedStatus"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) ModifyL4ProxyRulesStatusWithContext 

func (c *Client) ModifyL4ProxyRulesStatusWithContext(ctx context.Context, request *ModifyL4ProxyRulesStatusRequest) (response *ModifyL4ProxyRulesStatusResponse, err error)

ModifyL4ProxyRulesStatus This API is used to start or stop Layer 4 proxy forwarding rules, supporting both individual and batch operation.

error code that may be returned: 

OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_L4PROXYINBANNEDSTATUS = "OperationDenied.L4ProxyInBannedStatus"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) ModifyL4ProxyRulesWithContext 

func (c *Client) ModifyL4ProxyRulesWithContext(ctx context.Context, request *ModifyL4ProxyRulesRequest) (response *ModifyL4ProxyRulesResponse, err error)

ModifyL4ProxyRules This API is used to modify Layer 4 proxy forwarding rules, supporting both individual and batch modification.

error code that may be returned: 

INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_PARAMETERERROR = "InvalidParameter.ParameterError"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_L4PROXYINBANNEDSTATUS = "OperationDenied.L4ProxyInBannedStatus"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) ModifyL4ProxyStatus 

func (c *Client) ModifyL4ProxyStatus(request *ModifyL4ProxyStatusRequest) (response *ModifyL4ProxyStatusResponse, err error)

ModifyL4ProxyStatus This API is used to enable or disable a Layer 4 proxy instance.

error code that may be returned: 

INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_L4PROXYINBANNEDSTATUS = "OperationDenied.L4ProxyInBannedStatus"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) ModifyL4ProxyStatusWithContext 

func (c *Client) ModifyL4ProxyStatusWithContext(ctx context.Context, request *ModifyL4ProxyStatusRequest) (response *ModifyL4ProxyStatusResponse, err error)

ModifyL4ProxyStatus This API is used to enable or disable a Layer 4 proxy instance.

error code that may be returned: 

INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_L4PROXYINBANNEDSTATUS = "OperationDenied.L4ProxyInBannedStatus"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) ModifyL4ProxyWithContext 

func (c *Client) ModifyL4ProxyWithContext(ctx context.Context, request *ModifyL4ProxyRequest) (response *ModifyL4ProxyResponse, err error)

ModifyL4Proxy This API is used to modify the configuration of a Layer 4 proxy instance.

error code that may be returned: 

OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ACCELERATEMAINLANDDISABLE = "OperationDenied.AccelerateMainlandDisable"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_L4LACKOFRESOURCES = "OperationDenied.L4LackOfResources"
OPERATIONDENIED_L4PROXYINOFFLINESTATUS = "OperationDenied.L4ProxyInOfflineStatus"
OPERATIONDENIED_L4PROXYINPROCESSSTATUS = "OperationDenied.L4ProxyInProcessStatus"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) ModifyLoadBalancer 

func (c *Client) ModifyLoadBalancer(request *ModifyLoadBalancerRequest) (response *ModifyLoadBalancerResponse, err error)

ModifyLoadBalancer This API is used to modify LoadBalancer configuration. The load balancing feature is in beta test. If you need to use it, [contact us](https://intl.cloud.tencent.com/online?from_cn_redirect=1-service).

error code that may be returned: 

INVALIDPARAMETER_LOADBALANCERBINDL4NOTINSTABLESTATUS = "InvalidParameter.LoadBalancerBindL4NotInStableStatus"
INVALIDPARAMETER_LOADBALANCERBINDL7NOTINSTABLESTATUS = "InvalidParameter.LoadBalancerBindL7NotInStableStatus"

func (*Client) ModifyLoadBalancerWithContext 

func (c *Client) ModifyLoadBalancerWithContext(ctx context.Context, request *ModifyLoadBalancerRequest) (response *ModifyLoadBalancerResponse, err error)

ModifyLoadBalancer This API is used to modify LoadBalancer configuration. The load balancing feature is in beta test. If you need to use it, [contact us](https://intl.cloud.tencent.com/online?from_cn_redirect=1-service).

error code that may be returned: 

INVALIDPARAMETER_LOADBALANCERBINDL4NOTINSTABLESTATUS = "InvalidParameter.LoadBalancerBindL4NotInStableStatus"
INVALIDPARAMETER_LOADBALANCERBINDL7NOTINSTABLESTATUS = "InvalidParameter.LoadBalancerBindL7NotInStableStatus"

func (*Client) ModifyOriginGroup 

func (c *Client) ModifyOriginGroup(request *ModifyOriginGroupRequest) (response *ModifyOriginGroupResponse, err error)

ModifyOriginGroup This API is used to modify the configuration of an origin group. The original configuration will be overwritten.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INVALIDPARAMETER_HOSTHEADERINVALID = "InvalidParameter.HostHeaderInvalid"
INVALIDPARAMETER_INVALIDAWSREGION = "InvalidParameter.InvalidAwsRegion"
INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_ORIGINL4RECORDIPV4MIXDOMAIN = "InvalidParameter.OriginL4RecordIPV4MixDomain"
INVALIDPARAMETER_ORIGINL4RECORDMULTIDOMAIN = "InvalidParameter.OriginL4RecordMultiDomain"
INVALIDPARAMETER_ORIGINNAMEEXISTS = "InvalidParameter.OriginNameExists"
INVALIDPARAMETER_ORIGINRECORDFORMATERROR = "InvalidParameter.OriginRecordFormatError"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ACCELERATIONDOMAINSTATUSNOTINONLINE = "OperationDenied.AccelerationDomainStatusNotInOnline"
OPERATIONDENIED_L4STATUSNOTINONLINE = "OperationDenied.L4StatusNotInOnline"
OPERATIONDENIED_LOADBALANCESTATUSNOTINONLINE = "OperationDenied.LoadBalanceStatusNotInOnline"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) ModifyOriginGroupWithContext 

func (c *Client) ModifyOriginGroupWithContext(ctx context.Context, request *ModifyOriginGroupRequest) (response *ModifyOriginGroupResponse, err error)

ModifyOriginGroup This API is used to modify the configuration of an origin group. The original configuration will be overwritten.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
INVALIDPARAMETER_HOSTHEADERINVALID = "InvalidParameter.HostHeaderInvalid"
INVALIDPARAMETER_INVALIDAWSREGION = "InvalidParameter.InvalidAwsRegion"
INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_ORIGINL4RECORDIPV4MIXDOMAIN = "InvalidParameter.OriginL4RecordIPV4MixDomain"
INVALIDPARAMETER_ORIGINL4RECORDMULTIDOMAIN = "InvalidParameter.OriginL4RecordMultiDomain"
INVALIDPARAMETER_ORIGINNAMEEXISTS = "InvalidParameter.OriginNameExists"
INVALIDPARAMETER_ORIGINRECORDFORMATERROR = "InvalidParameter.OriginRecordFormatError"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ACCELERATIONDOMAINSTATUSNOTINONLINE = "OperationDenied.AccelerationDomainStatusNotInOnline"
OPERATIONDENIED_L4STATUSNOTINONLINE = "OperationDenied.L4StatusNotInOnline"
OPERATIONDENIED_LOADBALANCESTATUSNOTINONLINE = "OperationDenied.LoadBalanceStatusNotInOnline"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) ModifyPlan 

func (c *Client) ModifyPlan(request *ModifyPlanRequest) (response *ModifyPlanResponse, err error)

ModifyPlan Modify the plan settings. Currently, only the auto-renewal switch of prepaid plans can be modified.

error code that may be returned: 

INVALIDPARAMETER_PLANNOTFOUND = "InvalidParameter.PlanNotFound"
OPERATIONDENIED_ENTERPRISEPLANAUTORENEWUNSUPPORTED = "OperationDenied.EnterprisePlanAutoRenewUnsupported"
OPERATIONDENIED_PLANHASBEENISOLATED = "OperationDenied.PlanHasBeenIsolated"

func (*Client) ModifyPlanWithContext 

func (c *Client) ModifyPlanWithContext(ctx context.Context, request *ModifyPlanRequest) (response *ModifyPlanResponse, err error)

ModifyPlan Modify the plan settings. Currently, only the auto-renewal switch of prepaid plans can be modified.

error code that may be returned: 

INVALIDPARAMETER_PLANNOTFOUND = "InvalidParameter.PlanNotFound"
OPERATIONDENIED_ENTERPRISEPLANAUTORENEWUNSUPPORTED = "OperationDenied.EnterprisePlanAutoRenewUnsupported"
OPERATIONDENIED_PLANHASBEENISOLATED = "OperationDenied.PlanHasBeenIsolated"

func (*Client) ModifyRealtimeLogDeliveryTask 

func (c *Client) ModifyRealtimeLogDeliveryTask(request *ModifyRealtimeLogDeliveryTaskRequest) (response *ModifyRealtimeLogDeliveryTaskResponse, err error)

ModifyRealtimeLogDeliveryTask This API is used to modify the real-time log delivery task configuration. This API has the following restrictions:<li>Does not support modifying the destination type of the real-time log delivery task (TaskType);</li><li>Does not support modifying the data delivery type (LogType);</li><li>Does not support modifying the data delivery area (Area);</li><li>Does not support modifying the detailed destination configuration, such as log set and log topic, when the destination of the original real-time log delivery task is Tencent Cloud CLS.</li>

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_CREATELOGTOPICTASKAUTHFAILURE = "FailedOperation.CreateLogTopicTaskAuthFailure"
INVALIDPARAMETER_INVALIDLOGFORMATFIELDDELIMITER = "InvalidParameter.InvalidLogFormatFieldDelimiter"
INVALIDPARAMETER_INVALIDLOGFORMATFORMATTYPE = "InvalidParameter.InvalidLogFormatFormatType"
INVALIDPARAMETER_INVALIDLOGFORMATRECORDDELIMITER = "InvalidParameter.InvalidLogFormatRecordDelimiter"
LIMITEXCEEDED_CUSTOMLOGFIELDREGEXLIMITEXCEEDED = "LimitExceeded.CustomLogFieldRegexLimitExceeded"

func (*Client) ModifyRealtimeLogDeliveryTaskWithContext 

func (c *Client) ModifyRealtimeLogDeliveryTaskWithContext(ctx context.Context, request *ModifyRealtimeLogDeliveryTaskRequest) (response *ModifyRealtimeLogDeliveryTaskResponse, err error)

ModifyRealtimeLogDeliveryTask This API is used to modify the real-time log delivery task configuration. This API has the following restrictions:<li>Does not support modifying the destination type of the real-time log delivery task (TaskType);</li><li>Does not support modifying the data delivery type (LogType);</li><li>Does not support modifying the data delivery area (Area);</li><li>Does not support modifying the detailed destination configuration, such as log set and log topic, when the destination of the original real-time log delivery task is Tencent Cloud CLS.</li>

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_CREATELOGTOPICTASKAUTHFAILURE = "FailedOperation.CreateLogTopicTaskAuthFailure"
INVALIDPARAMETER_INVALIDLOGFORMATFIELDDELIMITER = "InvalidParameter.InvalidLogFormatFieldDelimiter"
INVALIDPARAMETER_INVALIDLOGFORMATFORMATTYPE = "InvalidParameter.InvalidLogFormatFormatType"
INVALIDPARAMETER_INVALIDLOGFORMATRECORDDELIMITER = "InvalidParameter.InvalidLogFormatRecordDelimiter"
LIMITEXCEEDED_CUSTOMLOGFIELDREGEXLIMITEXCEEDED = "LimitExceeded.CustomLogFieldRegexLimitExceeded"

func (*Client) ModifyRule 

func (c *Client) ModifyRule(request *ModifyRuleRequest) (response *ModifyRuleResponse, err error)

ModifyRule This API is used to modify a rule in the rule engine.

error code that may be returned: 

INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_CACHEKEYQUERYSTRINGTOOMANYVALUE = "InvalidParameter.CacheKeyQueryStringTooManyValue"
INVALIDPARAMETER_CERTSYSTEMERROR = "InvalidParameter.CertSystemError"
INVALIDPARAMETER_COMPRESSIONINVALIDALGORITHMS = "InvalidParameter.CompressionInvalidAlgorithms"
INVALIDPARAMETER_ERRACTIONUNSUPPORTTARGET = "InvalidParameter.ErrActionUnsupportTarget"
INVALIDPARAMETER_ERRINVALIDACTION = "InvalidParameter.ErrInvalidAction"
INVALIDPARAMETER_ERRINVALIDACTIONDUPLICATEACTION = "InvalidParameter.ErrInvalidActionDuplicateAction"
INVALIDPARAMETER_ERRINVALIDACTIONPARAM = "InvalidParameter.ErrInvalidActionParam"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMACTION = "InvalidParameter.ErrInvalidActionParamAction"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMDUPLICATENAME = "InvalidParameter.ErrInvalidActionParamDuplicateName"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMNAME = "InvalidParameter.ErrInvalidActionParamName"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMTOOMANYVALUES = "InvalidParameter.ErrInvalidActionParamTooManyValues"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMVALUE = "InvalidParameter.ErrInvalidActionParamValue"
INVALIDPARAMETER_ERRINVALIDACTIONTYPE = "InvalidParameter.ErrInvalidActionType"
INVALIDPARAMETER_ERRINVALIDCONDITIONHOSTTOOMANYWHENMODIFYORIGINACTIONCONFIGURED = "InvalidParameter.ErrInvalidConditionHostTooManyWhenModifyOriginActionConfigured"
INVALIDPARAMETER_ERRINVALIDCONDITIONIGNORECASE = "InvalidParameter.ErrInvalidConditionIgnoreCase"
INVALIDPARAMETER_ERRINVALIDCONDITIONNAMEBADNAME = "InvalidParameter.ErrInvalidConditionNameBadName"
INVALIDPARAMETER_ERRINVALIDCONDITIONNAMETARGETNOTSUPPORTNAME = "InvalidParameter.ErrInvalidConditionNameTargetNotSupportName"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADREGULAR = "InvalidParameter.ErrInvalidConditionValueBadRegular"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADURL = "InvalidParameter.ErrInvalidConditionValueBadUrl"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADVALUE = "InvalidParameter.ErrInvalidConditionValueBadValue"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADVALUECONTAINFILENAMEEXTENSION = "InvalidParameter.ErrInvalidConditionValueBadValueContainFileNameExtension"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUETOOLONGVALUE = "InvalidParameter.ErrInvalidConditionValueTooLongValue"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUETOOMANYVALUES = "InvalidParameter.ErrInvalidConditionValueTooManyValues"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUETOOMANYWILDCARD = "InvalidParameter.ErrInvalidConditionValueTooManyWildcard"
INVALIDPARAMETER_ERRINVALIDELSEWHENMODIFYORIGINACTIONCONFIGURED = "InvalidParameter.ErrInvalidElseWhenModifyOriginActionConfigured"
INVALIDPARAMETER_ERRNILCONDITION = "InvalidParameter.ErrNilCondition"
INVALIDPARAMETER_GRPCREQUIREHTTP2 = "InvalidParameter.GrpcRequireHttp2"
INVALIDPARAMETER_HOSTNOTFOUND = "InvalidParameter.HostNotFound"
INVALIDPARAMETER_INVALIDAUTHENTICATIONTYPESECRETKEY = "InvalidParameter.InvalidAuthenticationTypeSecretKey"
INVALIDPARAMETER_INVALIDAUTHENTICATIONTYPESIGNPARAM = "InvalidParameter.InvalidAuthenticationTypeSignParam"
INVALIDPARAMETER_INVALIDAUTHENTICATIONTYPETIMEFORMAT = "InvalidParameter.InvalidAuthenticationTypeTimeFormat"
INVALIDPARAMETER_INVALIDAUTHENTICATIONTYPETIMEPARAM = "InvalidParameter.InvalidAuthenticationTypeTimeParam"
INVALIDPARAMETER_INVALIDAWSREGION = "InvalidParameter.InvalidAwsRegion"
INVALIDPARAMETER_INVALIDBACKUPSERVERNAME = "InvalidParameter.InvalidBackupServerName"
INVALIDPARAMETER_INVALIDCACHEKEY = "InvalidParameter.InvalidCacheKey"
INVALIDPARAMETER_INVALIDCACHEKEYCOOKIE = "InvalidParameter.InvalidCacheKeyCookie"
INVALIDPARAMETER_INVALIDCACHEKEYIGNORECASE = "InvalidParameter.InvalidCacheKeyIgnoreCase"
INVALIDPARAMETER_INVALIDCACHEKEYSCHEME = "InvalidParameter.InvalidCacheKeyScheme"
INVALIDPARAMETER_INVALIDCACHETIME = "InvalidParameter.InvalidCacheTime"
INVALIDPARAMETER_INVALIDCLIENTIPHEADERNAME = "InvalidParameter.InvalidClientIpHeaderName"
INVALIDPARAMETER_INVALIDCOSDOMAIN = "InvalidParameter.InvalidCosDomain"
INVALIDPARAMETER_INVALIDERRORPAGEREDIRECTURL = "InvalidParameter.InvalidErrorPageRedirectUrl"
INVALIDPARAMETER_INVALIDHTTPSCIPHERSUITEANDTLSVERSION = "InvalidParameter.InvalidHttpsCipherSuiteAndTlsVersion"
INVALIDPARAMETER_INVALIDHTTPSHSTSMAXAGE = "InvalidParameter.InvalidHttpsHstsMaxAge"
INVALIDPARAMETER_INVALIDIPV6SWITCH = "InvalidParameter.InvalidIpv6Switch"
INVALIDPARAMETER_INVALIDMAXAGETIME = "InvalidParameter.InvalidMaxAgeTime"
INVALIDPARAMETER_INVALIDORIGIN = "InvalidParameter.InvalidOrigin"
INVALIDPARAMETER_INVALIDPARAMETER = "InvalidParameter.InvalidParameter"
INVALIDPARAMETER_INVALIDRANGEORIGINPULL = "InvalidParameter.InvalidRangeOriginPull"
INVALIDPARAMETER_INVALIDREQUESTHEADERNAME = "InvalidParameter.InvalidRequestHeaderName"
INVALIDPARAMETER_INVALIDREQUESTHEADERNAMEXFF = "InvalidParameter.InvalidRequestHeaderNameXff"
INVALIDPARAMETER_INVALIDREQUESTHEADERVALUE = "InvalidParameter.InvalidRequestHeaderValue"
INVALIDPARAMETER_INVALIDRESPONSEHEADERNAME = "InvalidParameter.InvalidResponseHeaderName"
INVALIDPARAMETER_INVALIDRESPONSEHEADERVALUE = "InvalidParameter.InvalidResponseHeaderValue"
INVALIDPARAMETER_INVALIDRULEENGINEACTION = "InvalidParameter.InvalidRuleEngineAction"
INVALIDPARAMETER_INVALIDRULEENGINENOTFOUND = "InvalidParameter.InvalidRuleEngineNotFound"
INVALIDPARAMETER_INVALIDRULEENGINETARGET = "InvalidParameter.InvalidRuleEngineTarget"
INVALIDPARAMETER_INVALIDRULEENGINETARGETSEXTENSION = "InvalidParameter.InvalidRuleEngineTargetsExtension"
INVALIDPARAMETER_INVALIDRULEENGINETARGETSURL = "InvalidParameter.InvalidRuleEngineTargetsUrl"
INVALIDPARAMETER_INVALIDSERVERNAME = "InvalidParameter.InvalidServerName"
INVALIDPARAMETER_INVALIDUPSTREAMREQUESTQUERYSTRINGVALUE = "InvalidParameter.InvalidUpstreamRequestQueryStringValue"
INVALIDPARAMETER_INVALIDURLREDIRECTHOST = "InvalidParameter.InvalidUrlRedirectHost"
INVALIDPARAMETER_INVALIDURLREDIRECTURL = "InvalidParameter.InvalidUrlRedirectUrl"
INVALIDPARAMETER_KEYRULESINVALIDQUERYSTRINGVALUE = "InvalidParameter.KeyRulesInvalidQueryStringValue"
INVALIDPARAMETER_LOADBALANCEINSTANCEIDISREQUIRED = "InvalidParameter.LoadBalanceInstanceIdIsRequired"
INVALIDPARAMETER_NOTSUPPORTTHISPRESET = "InvalidParameter.NotSupportThisPreset"
INVALIDPARAMETER_ORIGINORIGINGROUPIDISREQUIRED = "InvalidParameter.OriginOriginGroupIdIsRequired"
INVALIDPARAMETER_ORIGINPULLPROTOCOLISREQUIRED = "InvalidParameter.OriginPullProtocolIsRequired"
INVALIDPARAMETER_POSTMAXSIZELIMITEXCEEDED = "InvalidParameter.PostMaxSizeLimitExceeded"
INVALIDPARAMETER_RESPONSEHEADERCACHECONTROLNOTALLOWDELETE = "InvalidParameter.ResponseHeaderCacheControlNotAllowDelete"
INVALIDPARAMETER_STATUSCODECACHEINVALIDSTATUSCODE = "InvalidParameter.StatusCodeCacheInvalidStatusCode"
INVALIDPARAMETER_TLSVERSIONNOTINSEQUENCE = "InvalidParameter.TlsVersionNotInSequence"
INVALIDPARAMETERVALUE_FORMATMISMATCH = "InvalidParameterValue.FormatMismatch"
INVALIDPARAMETERVALUE_GENERALMISMATCH = "InvalidParameterValue.GeneralMismatch"
INVALIDPARAMETERVALUE_INCLUDEINVALIDVALUE = "InvalidParameterValue.IncludeInvalidValue"
INVALIDPARAMETERVALUE_MISSINGNECESSARYPARAM = "InvalidParameterValue.MissingNecessaryParam"
INVALIDPARAMETERVALUE_NOTINENUMERATION = "InvalidParameterValue.NotInEnumeration"
INVALIDPARAMETERVALUE_NOTWITHINRANGE = "InvalidParameterValue.NotWithinRange"
INVALIDPARAMETERVALUE_REGEXMISMATCH = "InvalidParameterValue.RegExMismatch"
INVALIDPARAMETERVALUE_UNRECOGNIZABLEVALUE = "InvalidParameterValue.UnrecognizableValue"
LIMITEXCEEDED = "LimitExceeded"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_INVALIDADVANCEDDEFENSESECURITYTYPE = "OperationDenied.InvalidAdvancedDefenseSecurityType"
RESOURCEINUSE = "ResourceInUse"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) ModifyRuleWithContext 

func (c *Client) ModifyRuleWithContext(ctx context.Context, request *ModifyRuleRequest) (response *ModifyRuleResponse, err error)

ModifyRule This API is used to modify a rule in the rule engine.

error code that may be returned: 

INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INVALIDPARAMETER_CACHEKEYQUERYSTRINGTOOMANYVALUE = "InvalidParameter.CacheKeyQueryStringTooManyValue"
INVALIDPARAMETER_CERTSYSTEMERROR = "InvalidParameter.CertSystemError"
INVALIDPARAMETER_COMPRESSIONINVALIDALGORITHMS = "InvalidParameter.CompressionInvalidAlgorithms"
INVALIDPARAMETER_ERRACTIONUNSUPPORTTARGET = "InvalidParameter.ErrActionUnsupportTarget"
INVALIDPARAMETER_ERRINVALIDACTION = "InvalidParameter.ErrInvalidAction"
INVALIDPARAMETER_ERRINVALIDACTIONDUPLICATEACTION = "InvalidParameter.ErrInvalidActionDuplicateAction"
INVALIDPARAMETER_ERRINVALIDACTIONPARAM = "InvalidParameter.ErrInvalidActionParam"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMACTION = "InvalidParameter.ErrInvalidActionParamAction"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMDUPLICATENAME = "InvalidParameter.ErrInvalidActionParamDuplicateName"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMNAME = "InvalidParameter.ErrInvalidActionParamName"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMTOOMANYVALUES = "InvalidParameter.ErrInvalidActionParamTooManyValues"
INVALIDPARAMETER_ERRINVALIDACTIONPARAMVALUE = "InvalidParameter.ErrInvalidActionParamValue"
INVALIDPARAMETER_ERRINVALIDACTIONTYPE = "InvalidParameter.ErrInvalidActionType"
INVALIDPARAMETER_ERRINVALIDCONDITIONHOSTTOOMANYWHENMODIFYORIGINACTIONCONFIGURED = "InvalidParameter.ErrInvalidConditionHostTooManyWhenModifyOriginActionConfigured"
INVALIDPARAMETER_ERRINVALIDCONDITIONIGNORECASE = "InvalidParameter.ErrInvalidConditionIgnoreCase"
INVALIDPARAMETER_ERRINVALIDCONDITIONNAMEBADNAME = "InvalidParameter.ErrInvalidConditionNameBadName"
INVALIDPARAMETER_ERRINVALIDCONDITIONNAMETARGETNOTSUPPORTNAME = "InvalidParameter.ErrInvalidConditionNameTargetNotSupportName"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADREGULAR = "InvalidParameter.ErrInvalidConditionValueBadRegular"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADURL = "InvalidParameter.ErrInvalidConditionValueBadUrl"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADVALUE = "InvalidParameter.ErrInvalidConditionValueBadValue"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUEBADVALUECONTAINFILENAMEEXTENSION = "InvalidParameter.ErrInvalidConditionValueBadValueContainFileNameExtension"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUETOOLONGVALUE = "InvalidParameter.ErrInvalidConditionValueTooLongValue"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUETOOMANYVALUES = "InvalidParameter.ErrInvalidConditionValueTooManyValues"
INVALIDPARAMETER_ERRINVALIDCONDITIONVALUETOOMANYWILDCARD = "InvalidParameter.ErrInvalidConditionValueTooManyWildcard"
INVALIDPARAMETER_ERRINVALIDELSEWHENMODIFYORIGINACTIONCONFIGURED = "InvalidParameter.ErrInvalidElseWhenModifyOriginActionConfigured"
INVALIDPARAMETER_ERRNILCONDITION = "InvalidParameter.ErrNilCondition"
INVALIDPARAMETER_GRPCREQUIREHTTP2 = "InvalidParameter.GrpcRequireHttp2"
INVALIDPARAMETER_HOSTNOTFOUND = "InvalidParameter.HostNotFound"
INVALIDPARAMETER_INVALIDAUTHENTICATIONTYPESECRETKEY = "InvalidParameter.InvalidAuthenticationTypeSecretKey"
INVALIDPARAMETER_INVALIDAUTHENTICATIONTYPESIGNPARAM = "InvalidParameter.InvalidAuthenticationTypeSignParam"
INVALIDPARAMETER_INVALIDAUTHENTICATIONTYPETIMEFORMAT = "InvalidParameter.InvalidAuthenticationTypeTimeFormat"
INVALIDPARAMETER_INVALIDAUTHENTICATIONTYPETIMEPARAM = "InvalidParameter.InvalidAuthenticationTypeTimeParam"
INVALIDPARAMETER_INVALIDAWSREGION = "InvalidParameter.InvalidAwsRegion"
INVALIDPARAMETER_INVALIDBACKUPSERVERNAME = "InvalidParameter.InvalidBackupServerName"
INVALIDPARAMETER_INVALIDCACHEKEY = "InvalidParameter.InvalidCacheKey"
INVALIDPARAMETER_INVALIDCACHEKEYCOOKIE = "InvalidParameter.InvalidCacheKeyCookie"
INVALIDPARAMETER_INVALIDCACHEKEYIGNORECASE = "InvalidParameter.InvalidCacheKeyIgnoreCase"
INVALIDPARAMETER_INVALIDCACHEKEYSCHEME = "InvalidParameter.InvalidCacheKeyScheme"
INVALIDPARAMETER_INVALIDCACHETIME = "InvalidParameter.InvalidCacheTime"
INVALIDPARAMETER_INVALIDCLIENTIPHEADERNAME = "InvalidParameter.InvalidClientIpHeaderName"
INVALIDPARAMETER_INVALIDCOSDOMAIN = "InvalidParameter.InvalidCosDomain"
INVALIDPARAMETER_INVALIDERRORPAGEREDIRECTURL = "InvalidParameter.InvalidErrorPageRedirectUrl"
INVALIDPARAMETER_INVALIDHTTPSCIPHERSUITEANDTLSVERSION = "InvalidParameter.InvalidHttpsCipherSuiteAndTlsVersion"
INVALIDPARAMETER_INVALIDHTTPSHSTSMAXAGE = "InvalidParameter.InvalidHttpsHstsMaxAge"
INVALIDPARAMETER_INVALIDIPV6SWITCH = "InvalidParameter.InvalidIpv6Switch"
INVALIDPARAMETER_INVALIDMAXAGETIME = "InvalidParameter.InvalidMaxAgeTime"
INVALIDPARAMETER_INVALIDORIGIN = "InvalidParameter.InvalidOrigin"
INVALIDPARAMETER_INVALIDPARAMETER = "InvalidParameter.InvalidParameter"
INVALIDPARAMETER_INVALIDRANGEORIGINPULL = "InvalidParameter.InvalidRangeOriginPull"
INVALIDPARAMETER_INVALIDREQUESTHEADERNAME = "InvalidParameter.InvalidRequestHeaderName"
INVALIDPARAMETER_INVALIDREQUESTHEADERNAMEXFF = "InvalidParameter.InvalidRequestHeaderNameXff"
INVALIDPARAMETER_INVALIDREQUESTHEADERVALUE = "InvalidParameter.InvalidRequestHeaderValue"
INVALIDPARAMETER_INVALIDRESPONSEHEADERNAME = "InvalidParameter.InvalidResponseHeaderName"
INVALIDPARAMETER_INVALIDRESPONSEHEADERVALUE = "InvalidParameter.InvalidResponseHeaderValue"
INVALIDPARAMETER_INVALIDRULEENGINEACTION = "InvalidParameter.InvalidRuleEngineAction"
INVALIDPARAMETER_INVALIDRULEENGINENOTFOUND = "InvalidParameter.InvalidRuleEngineNotFound"
INVALIDPARAMETER_INVALIDRULEENGINETARGET = "InvalidParameter.InvalidRuleEngineTarget"
INVALIDPARAMETER_INVALIDRULEENGINETARGETSEXTENSION = "InvalidParameter.InvalidRuleEngineTargetsExtension"
INVALIDPARAMETER_INVALIDRULEENGINETARGETSURL = "InvalidParameter.InvalidRuleEngineTargetsUrl"
INVALIDPARAMETER_INVALIDSERVERNAME = "InvalidParameter.InvalidServerName"
INVALIDPARAMETER_INVALIDUPSTREAMREQUESTQUERYSTRINGVALUE = "InvalidParameter.InvalidUpstreamRequestQueryStringValue"
INVALIDPARAMETER_INVALIDURLREDIRECTHOST = "InvalidParameter.InvalidUrlRedirectHost"
INVALIDPARAMETER_INVALIDURLREDIRECTURL = "InvalidParameter.InvalidUrlRedirectUrl"
INVALIDPARAMETER_KEYRULESINVALIDQUERYSTRINGVALUE = "InvalidParameter.KeyRulesInvalidQueryStringValue"
INVALIDPARAMETER_LOADBALANCEINSTANCEIDISREQUIRED = "InvalidParameter.LoadBalanceInstanceIdIsRequired"
INVALIDPARAMETER_NOTSUPPORTTHISPRESET = "InvalidParameter.NotSupportThisPreset"
INVALIDPARAMETER_ORIGINORIGINGROUPIDISREQUIRED = "InvalidParameter.OriginOriginGroupIdIsRequired"
INVALIDPARAMETER_ORIGINPULLPROTOCOLISREQUIRED = "InvalidParameter.OriginPullProtocolIsRequired"
INVALIDPARAMETER_POSTMAXSIZELIMITEXCEEDED = "InvalidParameter.PostMaxSizeLimitExceeded"
INVALIDPARAMETER_RESPONSEHEADERCACHECONTROLNOTALLOWDELETE = "InvalidParameter.ResponseHeaderCacheControlNotAllowDelete"
INVALIDPARAMETER_STATUSCODECACHEINVALIDSTATUSCODE = "InvalidParameter.StatusCodeCacheInvalidStatusCode"
INVALIDPARAMETER_TLSVERSIONNOTINSEQUENCE = "InvalidParameter.TlsVersionNotInSequence"
INVALIDPARAMETERVALUE_FORMATMISMATCH = "InvalidParameterValue.FormatMismatch"
INVALIDPARAMETERVALUE_GENERALMISMATCH = "InvalidParameterValue.GeneralMismatch"
INVALIDPARAMETERVALUE_INCLUDEINVALIDVALUE = "InvalidParameterValue.IncludeInvalidValue"
INVALIDPARAMETERVALUE_MISSINGNECESSARYPARAM = "InvalidParameterValue.MissingNecessaryParam"
INVALIDPARAMETERVALUE_NOTINENUMERATION = "InvalidParameterValue.NotInEnumeration"
INVALIDPARAMETERVALUE_NOTWITHINRANGE = "InvalidParameterValue.NotWithinRange"
INVALIDPARAMETERVALUE_REGEXMISMATCH = "InvalidParameterValue.RegExMismatch"
INVALIDPARAMETERVALUE_UNRECOGNIZABLEVALUE = "InvalidParameterValue.UnrecognizableValue"
LIMITEXCEEDED = "LimitExceeded"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_INVALIDADVANCEDDEFENSESECURITYTYPE = "OperationDenied.InvalidAdvancedDefenseSecurityType"
RESOURCEINUSE = "ResourceInUse"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) ModifySecurityIPGroup 

func (c *Client) ModifySecurityIPGroup(request *ModifySecurityIPGroupRequest) (response *ModifySecurityIPGroupResponse, err error)

ModifySecurityIPGroup This API is used to modify a security IP group.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INVALIDPARAMETER_SECURITY = "InvalidParameter.Security"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) ModifySecurityIPGroupWithContext 

func (c *Client) ModifySecurityIPGroupWithContext(ctx context.Context, request *ModifySecurityIPGroupRequest) (response *ModifySecurityIPGroupResponse, err error)

ModifySecurityIPGroup This API is used to modify a security IP group.

error code that may be returned: 

INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INVALIDPARAMETER_SECURITY = "InvalidParameter.Security"
RESOURCENOTFOUND = "ResourceNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"

func (*Client) ModifySecurityPolicy 

func (c *Client) ModifySecurityPolicy(request *ModifySecurityPolicyRequest) (response *ModifySecurityPolicyResponse, err error)

ModifySecurityPolicy This API is used to modify the web and bot security configurations.

error code that may be returned: 

INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
INVALIDPARAMETER_SECURITY = "InvalidParameter.Security"
LIMITEXCEEDED_SECURITY = "LimitExceeded.Security"
OPERATIONDENIED = "OperationDenied"
RESOURCEINUSE = "ResourceInUse"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"
UNSUPPORTEDOPERATION = "UnsupportedOperation"

func (*Client) ModifySecurityPolicyWithContext 

func (c *Client) ModifySecurityPolicyWithContext(ctx context.Context, request *ModifySecurityPolicyRequest) (response *ModifySecurityPolicyResponse, err error)

ModifySecurityPolicy This API is used to modify the web and bot security configurations.

error code that may be returned: 

INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_PROXYSERVER = "InternalError.ProxyServer"
INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
INVALIDPARAMETER_SECURITY = "InvalidParameter.Security"
LIMITEXCEEDED_SECURITY = "LimitExceeded.Security"
OPERATIONDENIED = "OperationDenied"
RESOURCEINUSE = "ResourceInUse"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"
UNAUTHORIZEDOPERATION_UNKNOWN = "UnauthorizedOperation.Unknown"
UNSUPPORTEDOPERATION = "UnsupportedOperation"

func (*Client) ModifyZone 

func (c *Client) ModifyZone(request *ModifyZoneRequest) (response *ModifyZoneResponse, err error)

ModifyZone This API is used to modify a site.

error code that may be returned: 

DRYRUNOPERATION = "DryRunOperation"
FAILEDOPERATION = "FailedOperation"
INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_FAILEDTOCALLDNSPOD = "InternalError.FailedToCallDNSPod"
INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_INVALIDWEBSOCKETTIMEOUT = "InvalidParameter.InvalidWebSocketTimeout"
INVALIDPARAMETER_LENGTHEXCEEDSLIMIT = "InvalidParameter.LengthExceedsLimit"
INVALIDPARAMETER_ZONENAMEISREQUIRED = "InvalidParameter.ZoneNameIsRequired"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
INVALIDPARAMETERVALUE_ZONESAMEASNAME = "InvalidParameterValue.ZoneSameAsName"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_DNSPODUNAUTHORIZEDROLEOPERATION = "OperationDenied.DNSPodUnauthorizedRoleOperation"
OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"
OPERATIONDENIED_DOMAININSHARECNAMEGROUP = "OperationDenied.DomainInShareCnameGroup"
OPERATIONDENIED_DOMAINNUMBERISNOTZERO = "OperationDenied.DomainNumberIsNotZero"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_MULTIPLECNAMEZONE = "OperationDenied.MultipleCnameZone"
OPERATIONDENIED_NSNOTALLOWTRAFFICSTRATEGY = "OperationDenied.NSNotAllowTrafficStrategy"
OPERATIONDENIED_NODOMAINACCESSZONEONLYALLOWMODIFIEDTOCNAME = "OperationDenied.NoDomainAccessZoneOnlyAllowModifiedToCNAME"
OPERATIONDENIED_NODOMAINACCESSZONEONLYSUPPORTMODIFYTYPE = "OperationDenied.NoDomainAccessZoneOnlySupportModifyType"
OPERATIONDENIED_PLANNOTSUPPORTMODIFYZONEAREA = "OperationDenied.PlanNotSupportModifyZoneArea"
OPERATIONDENIED_RESOURCELOCKEDTEMPORARY = "OperationDenied.ResourceLockedTemporary"
RESOURCEINUSE_CNAME = "ResourceInUse.Cname"
RESOURCEINUSE_DNS = "ResourceInUse.Dns"
RESOURCEINUSE_GENERICHOST = "ResourceInUse.GenericHost"
RESOURCEINUSE_NS = "ResourceInUse.NS"
RESOURCEINUSE_OTHERS = "ResourceInUse.Others"
RESOURCEINUSE_OTHERSALIASDOMAIN = "ResourceInUse.OthersAliasDomain"
RESOURCEINUSE_OTHERSCNAME = "ResourceInUse.OthersCname"
RESOURCEINUSE_OTHERSNS = "ResourceInUse.OthersNS"
RESOURCEINUSE_SELFANDOTHERSCNAME = "ResourceInUse.SelfAndOthersCname"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCENOTFOUND_DNSPODDOMAINNOTINACCOUNT = "ResourceNotFound.DNSPodDomainNotInAccount"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"

func (*Client) ModifyZoneSetting 

func (c *Client) ModifyZoneSetting(request *ModifyZoneSettingRequest) (response *ModifyZoneSettingResponse, err error)

ModifyZoneSetting This API is used to modify the site configuration.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_CERTIFICATENOTFOUND = "FailedOperation.CertificateNotFound"
INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INTERNALERROR_UNKNOWERROR = "InternalError.UnknowError"
INVALIDPARAMETER_ACTIONINPROGRESS = "InvalidParameter.ActionInProgress"
INVALIDPARAMETER_CACHEKEYQUERYSTRINGREQUIRESFULLURLCACHEOFF = "InvalidParameter.CacheKeyQueryStringRequiresFullUrlCacheOff"
INVALIDPARAMETER_CACHEKEYQUERYSTRINGTOOMANYVALUE = "InvalidParameter.CacheKeyQueryStringTooManyValue"
INVALIDPARAMETER_CERTSYSTEMERROR = "InvalidParameter.CertSystemError"
INVALIDPARAMETER_CLIENTIPCOUNTRYCONFLICTSWITHIPV6 = "InvalidParameter.ClientIpCountryConflictsWithIpv6"
INVALIDPARAMETER_GRPCREQUIREHTTP2 = "InvalidParameter.GrpcRequireHttp2"
INVALIDPARAMETER_INVALIDAWSPRIVATEACCESS = "InvalidParameter.InvalidAwsPrivateAccess"
INVALIDPARAMETER_INVALIDCACHECONFIGFOLLOWORIGIN = "InvalidParameter.InvalidCacheConfigFollowOrigin"
INVALIDPARAMETER_INVALIDCACHEKEYQUERYSTRINGVALUE = "InvalidParameter.InvalidCacheKeyQueryStringValue"
INVALIDPARAMETER_INVALIDCACHEONLYONSWITCH = "InvalidParameter.InvalidCacheOnlyOnSwitch"
INVALIDPARAMETER_INVALIDCACHETIME = "InvalidParameter.InvalidCacheTime"
INVALIDPARAMETER_INVALIDCLIENTIPCOUNTRYHEADERNAME = "InvalidParameter.InvalidClientIpCountryHeaderName"
INVALIDPARAMETER_INVALIDCLIENTIPHEADERNAME = "InvalidParameter.InvalidClientIpHeaderName"
INVALIDPARAMETER_INVALIDDYNAMICROUTINE = "InvalidParameter.InvalidDynamicRoutine"
INVALIDPARAMETER_INVALIDDYNAMICROUTINEBILLING = "InvalidParameter.InvalidDynamicRoutineBilling"
INVALIDPARAMETER_INVALIDFORCEREDIRECTTYPE = "InvalidParameter.InvalidForceRedirectType"
INVALIDPARAMETER_INVALIDHTTPS = "InvalidParameter.InvalidHttps"
INVALIDPARAMETER_INVALIDHTTPSCERTINFO = "InvalidParameter.InvalidHttpsCertInfo"
INVALIDPARAMETER_INVALIDHTTPSCIPHERSUITEANDTLSVERSION = "InvalidParameter.InvalidHttpsCipherSuiteAndTlsVersion"
INVALIDPARAMETER_INVALIDHTTPSHSTSMAXAGE = "InvalidParameter.InvalidHttpsHstsMaxAge"
INVALIDPARAMETER_INVALIDHTTPSTLSVERSION = "InvalidParameter.InvalidHttpsTlsVersion"
INVALIDPARAMETER_INVALIDIPV6SWITCH = "InvalidParameter.InvalidIpv6Switch"
INVALIDPARAMETER_INVALIDMAXAGETIME = "InvalidParameter.InvalidMaxAgeTime"
INVALIDPARAMETER_INVALIDORIGIN = "InvalidParameter.InvalidOrigin"
INVALIDPARAMETER_INVALIDORIGINTYPE = "InvalidParameter.InvalidOriginType"
INVALIDPARAMETER_INVALIDPARAMETER = "InvalidParameter.InvalidParameter"
INVALIDPARAMETER_INVALIDPOSTMAXSIZEBILLING = "InvalidParameter.InvalidPostMaxSizeBilling"
INVALIDPARAMETER_INVALIDPOSTSIZEVALUE = "InvalidParameter.InvalidPostSizeValue"
INVALIDPARAMETER_INVALIDRANGEORIGINPULL = "InvalidParameter.InvalidRangeOriginPull"
INVALIDPARAMETER_INVALIDREQUESTHEADERNAME = "InvalidParameter.InvalidRequestHeaderName"
INVALIDPARAMETER_INVALIDRESOURCEIDBILLING = "InvalidParameter.InvalidResourceIdBilling"
INVALIDPARAMETER_INVALIDSTANDARDDEBUGCLIENTIP = "InvalidParameter.InvalidStandardDebugClientIp"
INVALIDPARAMETER_INVALIDSTANDARDDEBUGEMPTYLIST = "InvalidParameter.InvalidStandardDebugEmptyList"
INVALIDPARAMETER_INVALIDSTANDARDDEBUGEXPIRETIMELIMIT = "InvalidParameter.InvalidStandardDebugExpireTimeLimit"
INVALIDPARAMETER_INVALIDWEBSOCKETTIMEOUT = "InvalidParameter.InvalidWebSocketTimeout"
INVALIDPARAMETER_MULTIPLYLAYERNOTSUPPORTSMARTROUTING = "InvalidParameter.MultiplyLayerNotSupportSmartRouting"
INVALIDPARAMETER_OCDIRECTORIGINREQUIRESSMARTROUTING = "InvalidParameter.OCDirectOriginRequiresSmartRouting"
INVALIDPARAMETER_POSTMAXSIZELIMITEXCEEDED = "InvalidParameter.PostMaxSizeLimitExceeded"
INVALIDPARAMETER_SETTINGINVALIDPARAM = "InvalidParameter.SettingInvalidParam"
INVALIDPARAMETER_ZONEISGRAYPUBLISHING = "InvalidParameter.ZoneIsGrayPublishing"
INVALIDPARAMETER_ZONENOTFOUND = "InvalidParameter.ZoneNotFound"
INVALIDPARAMETERVALUE_FORMATMISMATCH = "InvalidParameterValue.FormatMismatch"
INVALIDPARAMETERVALUE_GENERALMISMATCH = "InvalidParameterValue.GeneralMismatch"
INVALIDPARAMETERVALUE_INCLUDEINVALIDVALUE = "InvalidParameterValue.IncludeInvalidValue"
INVALIDPARAMETERVALUE_MISSINGNECESSARYPARAM = "InvalidParameterValue.MissingNecessaryParam"
INVALIDPARAMETERVALUE_NOTINENUMERATION = "InvalidParameterValue.NotInEnumeration"
INVALIDPARAMETERVALUE_NOTWITHINRANGE = "InvalidParameterValue.NotWithinRange"
INVALIDPARAMETERVALUE_REGEXMISMATCH = "InvalidParameterValue.RegExMismatch"
INVALIDPARAMETERVALUE_UNRECOGNIZABLEVALUE = "InvalidParameterValue.UnrecognizableValue"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ACCELERATEMAINLANDDISABLE = "OperationDenied.AccelerateMainlandDisable"
OPERATIONDENIED_ACCELERATEMAINLANDIPV6CONFLICT = "OperationDenied.AccelerateMainlandIpv6Conflict"
OPERATIONDENIED_ACCELERATEMAINLANDMULTIPLYLAYERCONFLICT = "OperationDenied.AccelerateMainlandMultiplyLayerConflict"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_SHAREDCNAMEUNSUPPORTEDACCELERATEMAINLAND = "OperationDenied.SharedCNAMEUnsupportedAccelerateMainland"
OPERATIONDENIED_SHAREDCNAMEUNSUPPORTEDIPV6 = "OperationDenied.SharedCNAMEUnsupportedIPv6"
RESOURCEINUSE = "ResourceInUse"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCENOTFOUND_POSTMAXSIZEQUOTANOTFOUND = "ResourceNotFound.PostMaxSizeQuotaNotFound"
RESOURCEUNAVAILABLE_CERTNOTFOUND = "ResourceUnavailable.CertNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"

func (*Client) ModifyZoneSettingWithContext 

func (c *Client) ModifyZoneSettingWithContext(ctx context.Context, request *ModifyZoneSettingRequest) (response *ModifyZoneSettingResponse, err error)

ModifyZoneSetting This API is used to modify the site configuration.

error code that may be returned: 

FAILEDOPERATION = "FailedOperation"
FAILEDOPERATION_CERTIFICATENOTFOUND = "FailedOperation.CertificateNotFound"
INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
INTERNALERROR_SYSTEMERROR = "InternalError.SystemError"
INTERNALERROR_UNKNOWERROR = "InternalError.UnknowError"
INVALIDPARAMETER_ACTIONINPROGRESS = "InvalidParameter.ActionInProgress"
INVALIDPARAMETER_CACHEKEYQUERYSTRINGREQUIRESFULLURLCACHEOFF = "InvalidParameter.CacheKeyQueryStringRequiresFullUrlCacheOff"
INVALIDPARAMETER_CACHEKEYQUERYSTRINGTOOMANYVALUE = "InvalidParameter.CacheKeyQueryStringTooManyValue"
INVALIDPARAMETER_CERTSYSTEMERROR = "InvalidParameter.CertSystemError"
INVALIDPARAMETER_CLIENTIPCOUNTRYCONFLICTSWITHIPV6 = "InvalidParameter.ClientIpCountryConflictsWithIpv6"
INVALIDPARAMETER_GRPCREQUIREHTTP2 = "InvalidParameter.GrpcRequireHttp2"
INVALIDPARAMETER_INVALIDAWSPRIVATEACCESS = "InvalidParameter.InvalidAwsPrivateAccess"
INVALIDPARAMETER_INVALIDCACHECONFIGFOLLOWORIGIN = "InvalidParameter.InvalidCacheConfigFollowOrigin"
INVALIDPARAMETER_INVALIDCACHEKEYQUERYSTRINGVALUE = "InvalidParameter.InvalidCacheKeyQueryStringValue"
INVALIDPARAMETER_INVALIDCACHEONLYONSWITCH = "InvalidParameter.InvalidCacheOnlyOnSwitch"
INVALIDPARAMETER_INVALIDCACHETIME = "InvalidParameter.InvalidCacheTime"
INVALIDPARAMETER_INVALIDCLIENTIPCOUNTRYHEADERNAME = "InvalidParameter.InvalidClientIpCountryHeaderName"
INVALIDPARAMETER_INVALIDCLIENTIPHEADERNAME = "InvalidParameter.InvalidClientIpHeaderName"
INVALIDPARAMETER_INVALIDDYNAMICROUTINE = "InvalidParameter.InvalidDynamicRoutine"
INVALIDPARAMETER_INVALIDDYNAMICROUTINEBILLING = "InvalidParameter.InvalidDynamicRoutineBilling"
INVALIDPARAMETER_INVALIDFORCEREDIRECTTYPE = "InvalidParameter.InvalidForceRedirectType"
INVALIDPARAMETER_INVALIDHTTPS = "InvalidParameter.InvalidHttps"
INVALIDPARAMETER_INVALIDHTTPSCERTINFO = "InvalidParameter.InvalidHttpsCertInfo"
INVALIDPARAMETER_INVALIDHTTPSCIPHERSUITEANDTLSVERSION = "InvalidParameter.InvalidHttpsCipherSuiteAndTlsVersion"
INVALIDPARAMETER_INVALIDHTTPSHSTSMAXAGE = "InvalidParameter.InvalidHttpsHstsMaxAge"
INVALIDPARAMETER_INVALIDHTTPSTLSVERSION = "InvalidParameter.InvalidHttpsTlsVersion"
INVALIDPARAMETER_INVALIDIPV6SWITCH = "InvalidParameter.InvalidIpv6Switch"
INVALIDPARAMETER_INVALIDMAXAGETIME = "InvalidParameter.InvalidMaxAgeTime"
INVALIDPARAMETER_INVALIDORIGIN = "InvalidParameter.InvalidOrigin"
INVALIDPARAMETER_INVALIDORIGINTYPE = "InvalidParameter.InvalidOriginType"
INVALIDPARAMETER_INVALIDPARAMETER = "InvalidParameter.InvalidParameter"
INVALIDPARAMETER_INVALIDPOSTMAXSIZEBILLING = "InvalidParameter.InvalidPostMaxSizeBilling"
INVALIDPARAMETER_INVALIDPOSTSIZEVALUE = "InvalidParameter.InvalidPostSizeValue"
INVALIDPARAMETER_INVALIDRANGEORIGINPULL = "InvalidParameter.InvalidRangeOriginPull"
INVALIDPARAMETER_INVALIDREQUESTHEADERNAME = "InvalidParameter.InvalidRequestHeaderName"
INVALIDPARAMETER_INVALIDRESOURCEIDBILLING = "InvalidParameter.InvalidResourceIdBilling"
INVALIDPARAMETER_INVALIDSTANDARDDEBUGCLIENTIP = "InvalidParameter.InvalidStandardDebugClientIp"
INVALIDPARAMETER_INVALIDSTANDARDDEBUGEMPTYLIST = "InvalidParameter.InvalidStandardDebugEmptyList"
INVALIDPARAMETER_INVALIDSTANDARDDEBUGEXPIRETIMELIMIT = "InvalidParameter.InvalidStandardDebugExpireTimeLimit"
INVALIDPARAMETER_INVALIDWEBSOCKETTIMEOUT = "InvalidParameter.InvalidWebSocketTimeout"
INVALIDPARAMETER_MULTIPLYLAYERNOTSUPPORTSMARTROUTING = "InvalidParameter.MultiplyLayerNotSupportSmartRouting"
INVALIDPARAMETER_OCDIRECTORIGINREQUIRESSMARTROUTING = "InvalidParameter.OCDirectOriginRequiresSmartRouting"
INVALIDPARAMETER_POSTMAXSIZELIMITEXCEEDED = "InvalidParameter.PostMaxSizeLimitExceeded"
INVALIDPARAMETER_SETTINGINVALIDPARAM = "InvalidParameter.SettingInvalidParam"
INVALIDPARAMETER_ZONEISGRAYPUBLISHING = "InvalidParameter.ZoneIsGrayPublishing"
INVALIDPARAMETER_ZONENOTFOUND = "InvalidParameter.ZoneNotFound"
INVALIDPARAMETERVALUE_FORMATMISMATCH = "InvalidParameterValue.FormatMismatch"
INVALIDPARAMETERVALUE_GENERALMISMATCH = "InvalidParameterValue.GeneralMismatch"
INVALIDPARAMETERVALUE_INCLUDEINVALIDVALUE = "InvalidParameterValue.IncludeInvalidValue"
INVALIDPARAMETERVALUE_MISSINGNECESSARYPARAM = "InvalidParameterValue.MissingNecessaryParam"
INVALIDPARAMETERVALUE_NOTINENUMERATION = "InvalidParameterValue.NotInEnumeration"
INVALIDPARAMETERVALUE_NOTWITHINRANGE = "InvalidParameterValue.NotWithinRange"
INVALIDPARAMETERVALUE_REGEXMISMATCH = "InvalidParameterValue.RegExMismatch"
INVALIDPARAMETERVALUE_UNRECOGNIZABLEVALUE = "InvalidParameterValue.UnrecognizableValue"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_ACCELERATEMAINLANDDISABLE = "OperationDenied.AccelerateMainlandDisable"
OPERATIONDENIED_ACCELERATEMAINLANDIPV6CONFLICT = "OperationDenied.AccelerateMainlandIpv6Conflict"
OPERATIONDENIED_ACCELERATEMAINLANDMULTIPLYLAYERCONFLICT = "OperationDenied.AccelerateMainlandMultiplyLayerConflict"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_SHAREDCNAMEUNSUPPORTEDACCELERATEMAINLAND = "OperationDenied.SharedCNAMEUnsupportedAccelerateMainland"
OPERATIONDENIED_SHAREDCNAMEUNSUPPORTEDIPV6 = "OperationDenied.SharedCNAMEUnsupportedIPv6"
RESOURCEINUSE = "ResourceInUse"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCENOTFOUND_POSTMAXSIZEQUOTANOTFOUND = "ResourceNotFound.PostMaxSizeQuotaNotFound"
RESOURCEUNAVAILABLE_CERTNOTFOUND = "ResourceUnavailable.CertNotFound"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"

func (*Client) ModifyZoneStatus 

func (c *Client) ModifyZoneStatus(request *ModifyZoneStatusRequest) (response *ModifyZoneStatusResponse, err error)

ModifyZoneStatus This API is used to change the site status.

error code that may be returned: 

OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"
OPERATIONDENIED_L4PROXYINPROGRESSSTATUS = "OperationDenied.L4ProxyInProgressStatus"
OPERATIONDENIED_L4PROXYINSTOPPINGSTATUS = "OperationDenied.L4ProxyInStoppingStatus"
OPERATIONDENIED_L7HOSTINPROCESSSTATUS = "OperationDenied.L7HostInProcessStatus"
OPERATIONDENIED_RESOURCELOCKEDTEMPORARY = "OperationDenied.ResourceLockedTemporary"
OPERATIONDENIED_VERSIONCONTROLISGRAYING = "OperationDenied.VersionControlIsGraying"
RESOURCEINUSE = "ResourceInUse"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) ModifyZoneStatusWithContext 

func (c *Client) ModifyZoneStatusWithContext(ctx context.Context, request *ModifyZoneStatusRequest) (response *ModifyZoneStatusResponse, err error)

ModifyZoneStatus This API is used to change the site status.

error code that may be returned: 

OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_CONFIGLOCKED = "OperationDenied.ConfigLocked"
OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"
OPERATIONDENIED_L4PROXYINPROGRESSSTATUS = "OperationDenied.L4ProxyInProgressStatus"
OPERATIONDENIED_L4PROXYINSTOPPINGSTATUS = "OperationDenied.L4ProxyInStoppingStatus"
OPERATIONDENIED_L7HOSTINPROCESSSTATUS = "OperationDenied.L7HostInProcessStatus"
OPERATIONDENIED_RESOURCELOCKEDTEMPORARY = "OperationDenied.ResourceLockedTemporary"
OPERATIONDENIED_VERSIONCONTROLISGRAYING = "OperationDenied.VersionControlIsGraying"
RESOURCEINUSE = "ResourceInUse"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"

func (*Client) ModifyZoneWithContext 

func (c *Client) ModifyZoneWithContext(ctx context.Context, request *ModifyZoneRequest) (response *ModifyZoneResponse, err error)

ModifyZone This API is used to modify a site.

error code that may be returned: 

DRYRUNOPERATION = "DryRunOperation"
FAILEDOPERATION = "FailedOperation"
INTERNALERROR_CONFIGLOCKED = "InternalError.ConfigLocked"
INTERNALERROR_FAILEDTOCALLDNSPOD = "InternalError.FailedToCallDNSPod"
INVALIDPARAMETER_INVALIDORIGINIP = "InvalidParameter.InvalidOriginIp"
INVALIDPARAMETER_INVALIDWEBSOCKETTIMEOUT = "InvalidParameter.InvalidWebSocketTimeout"
INVALIDPARAMETER_LENGTHEXCEEDSLIMIT = "InvalidParameter.LengthExceedsLimit"
INVALIDPARAMETER_ZONENAMEISREQUIRED = "InvalidParameter.ZoneNameIsRequired"
INVALIDPARAMETERVALUE = "InvalidParameterValue"
INVALIDPARAMETERVALUE_ZONESAMEASNAME = "InvalidParameterValue.ZoneSameAsName"
OPERATIONDENIED = "OperationDenied"
OPERATIONDENIED_DNSPODUNAUTHORIZEDROLEOPERATION = "OperationDenied.DNSPodUnauthorizedRoleOperation"
OPERATIONDENIED_DISABLEZONENOTCOMPLETED = "OperationDenied.DisableZoneNotCompleted"
OPERATIONDENIED_DOMAININSHARECNAMEGROUP = "OperationDenied.DomainInShareCnameGroup"
OPERATIONDENIED_DOMAINNUMBERISNOTZERO = "OperationDenied.DomainNumberIsNotZero"
OPERATIONDENIED_ERRZONEISALREADYPAUSED = "OperationDenied.ErrZoneIsAlreadyPaused"
OPERATIONDENIED_MULTIPLECNAMEZONE = "OperationDenied.MultipleCnameZone"
OPERATIONDENIED_NSNOTALLOWTRAFFICSTRATEGY = "OperationDenied.NSNotAllowTrafficStrategy"
OPERATIONDENIED_NODOMAINACCESSZONEONLYALLOWMODIFIEDTOCNAME = "OperationDenied.NoDomainAccessZoneOnlyAllowModifiedToCNAME"
OPERATIONDENIED_NODOMAINACCESSZONEONLYSUPPORTMODIFYTYPE = "OperationDenied.NoDomainAccessZoneOnlySupportModifyType"
OPERATIONDENIED_PLANNOTSUPPORTMODIFYZONEAREA = "OperationDenied.PlanNotSupportModifyZoneArea"
OPERATIONDENIED_RESOURCELOCKEDTEMPORARY = "OperationDenied.ResourceLockedTemporary"
RESOURCEINUSE_CNAME = "ResourceInUse.Cname"
RESOURCEINUSE_DNS = "ResourceInUse.Dns"
RESOURCEINUSE_GENERICHOST = "ResourceInUse.GenericHost"
RESOURCEINUSE_NS = "ResourceInUse.NS"
RESOURCEINUSE_OTHERS = "ResourceInUse.Others"
RESOURCEINUSE_OTHERSALIASDOMAIN = "ResourceInUse.OthersAliasDomain"
RESOURCEINUSE_OTHERSCNAME = "ResourceInUse.OthersCname"
RESOURCEINUSE_OTHERSNS = "ResourceInUse.OthersNS"
RESOURCEINUSE_SELFANDOTHERSCNAME = "ResourceInUse.SelfAndOthersCname"
RESOURCENOTFOUND = "ResourceNotFound"
RESOURCENOTFOUND_DNSPODDOMAINNOTINACCOUNT = "ResourceNotFound.DNSPodDomainNotInAccount"
RESOURCEUNAVAILABLE = "ResourceUnavailable"
UNAUTHORIZEDOPERATION_CAMUNAUTHORIZED = "UnauthorizedOperation.CamUnauthorized"
UNAUTHORIZEDOPERATION_NOPERMISSION = "UnauthorizedOperation.NoPermission"

func (*Client) RenewPlan 

func (c *Client) RenewPlan(request *RenewPlanRequest) (response *RenewPlanResponse, err error)

RenewPlan When your plan needs to be extended, you can use this interface to renew it. Plan renewal is only supported for the Personal, Basic, and Standard Editions.

> For cost details, refer to [Plan Fees](https://intl.cloud.tencent.com/document/product/1552/94158?from_cn_redirect=1).

error code that may be returned: 

FAILEDOPERATION_INSUFFICIENTACCOUNTBALANCE = "FailedOperation.InsufficientAccountBalance"
INVALIDPARAMETER_INVALIDAUTOUSEVOUCHER = "InvalidParameter.InvalidAutoUseVoucher"
INVALIDPARAMETER_INVALIDPERIOD = "InvalidParameter.InvalidPeriod"
INVALIDPARAMETER_PLANNOTFOUND = "InvalidParameter.PlanNotFound"
OPERATIONDENIED_ENTERPRISEPLANRENEWUNSUPPORTED = "OperationDenied.EnterprisePlanRenewUnsupported"
OPERATIONDENIED_RESOURCEHASBEENLOCKED = "OperationDenied.ResourceHasBeenLocked"

func (*Client) RenewPlanWithContext 

func (c *Client) RenewPlanWithContext(ctx context.Context, request *RenewPlanRequest) (response *RenewPlanResponse, err error)

RenewPlan When your plan needs to be extended, you can use this interface to renew it. Plan renewal is only supported for the Personal, Basic, and Standard Editions.

> For cost details, refer to [Plan Fees](https://intl.cloud.tencent.com/document/product/1552/94158?from_cn_redirect=1).

error code that may be returned: 

FAILEDOPERATION_INSUFFICIENTACCOUNTBALANCE = "FailedOperation.InsufficientAccountBalance"
INVALIDPARAMETER_INVALIDAUTOUSEVOUCHER = "InvalidParameter.InvalidAutoUseVoucher"
INVALIDPARAMETER_INVALIDPERIOD = "InvalidParameter.InvalidPeriod"
INVALIDPARAMETER_PLANNOTFOUND = "InvalidParameter.PlanNotFound"
OPERATIONDENIED_ENTERPRISEPLANRENEWUNSUPPORTED = "OperationDenied.EnterprisePlanRenewUnsupported"
OPERATIONDENIED_RESOURCEHASBEENLOCKED = "OperationDenied.ResourceHasBeenLocked"

func (*Client) UpgradePlan 

func (c *Client) UpgradePlan(request *UpgradePlanRequest) (response *UpgradePlanResponse, err error)

UpgradePlan When you need features available only in higher-tier plans, you can upgrade your plan through this interface. Upgrades are only supported for Personal and Basic Edition Plans.

> For differences between EdgeOne billing plans, refer to [Comparison of EdgeOne Plans](https://intl.cloud.tencent.com/document/product/1552/94165?from_cn_redirect=1).

For EdgeOne plan upgrade rules and pricing details, refer to [EdgeOne Plan Upgrade Guide](https://intl.cloud.tencent.com/document/product/1552/95291?from_cn_redirect=1).

If your plan needs to upgrade to the Enterprise Edition, [Contact Us](https://intl.cloud.tencent.com/online?from_cn_redirect=1-service).

error code that may be returned: 

FAILEDOPERATION_INSUFFICIENTACCOUNTBALANCE = "FailedOperation.InsufficientAccountBalance"
INVALIDPARAMETER_INVALIDAUTOUSEVOUCHER = "InvalidParameter.InvalidAutoUseVoucher"
INVALIDPARAMETER_INVALIDPLANTYPE = "InvalidParameter.InvalidPlanType"
INVALIDPARAMETER_PLANNOTFOUND = "InvalidParameter.PlanNotFound"
OPERATIONDENIED_ENTERPRISEPLANUPGRADEUNSUPPORTED = "OperationDenied.EnterprisePlanUpgradeUnsupported"
OPERATIONDENIED_PLANDOWNGRADENOTALLOWED = "OperationDenied.PlanDowngradeNotAllowed"
OPERATIONDENIED_PLANHASBEENEXPIRED = "OperationDenied.PlanHasBeenExpired"
OPERATIONDENIED_PLANHASBEENISOLATED = "OperationDenied.PlanHasBeenIsolated"
OPERATIONDENIED_RESOURCEHASBEENLOCKED = "OperationDenied.ResourceHasBeenLocked"

func (*Client) UpgradePlanWithContext 

func (c *Client) UpgradePlanWithContext(ctx context.Context, request *UpgradePlanRequest) (response *UpgradePlanResponse, err error)

UpgradePlan When you need features available only in higher-tier plans, you can upgrade your plan through this interface. Upgrades are only supported for Personal and Basic Edition Plans.

> For differences between EdgeOne billing plans, refer to [Comparison of EdgeOne Plans](https://intl.cloud.tencent.com/document/product/1552/94165?from_cn_redirect=1).

For EdgeOne plan upgrade rules and pricing details, refer to [EdgeOne Plan Upgrade Guide](https://intl.cloud.tencent.com/document/product/1552/95291?from_cn_redirect=1).

If your plan needs to upgrade to the Enterprise Edition, [Contact Us](https://intl.cloud.tencent.com/online?from_cn_redirect=1-service).

error code that may be returned: 

FAILEDOPERATION_INSUFFICIENTACCOUNTBALANCE = "FailedOperation.InsufficientAccountBalance"
INVALIDPARAMETER_INVALIDAUTOUSEVOUCHER = "InvalidParameter.InvalidAutoUseVoucher"
INVALIDPARAMETER_INVALIDPLANTYPE = "InvalidParameter.InvalidPlanType"
INVALIDPARAMETER_PLANNOTFOUND = "InvalidParameter.PlanNotFound"
OPERATIONDENIED_ENTERPRISEPLANUPGRADEUNSUPPORTED = "OperationDenied.EnterprisePlanUpgradeUnsupported"
OPERATIONDENIED_PLANDOWNGRADENOTALLOWED = "OperationDenied.PlanDowngradeNotAllowed"
OPERATIONDENIED_PLANHASBEENEXPIRED = "OperationDenied.PlanHasBeenExpired"
OPERATIONDENIED_PLANHASBEENISOLATED = "OperationDenied.PlanHasBeenIsolated"
OPERATIONDENIED_RESOURCEHASBEENLOCKED = "OperationDenied.ResourceHasBeenLocked"

func (*Client) VerifyOwnership 

func (c *Client) VerifyOwnership(request *VerifyOwnershipRequest) (response *VerifyOwnershipResponse, err error)

VerifyOwnership This API is used to verify your ownership of a site or domain name. It's required in the CNAME access mode. After a site is verified, you don't need to verify the ownership again for domain names added to it in the future. For details, see [Ownership Verification](https://intl.cloud.tencent.com/document/product/1552/70789?from_cn_redirect=1).

For sites connected via the NS, you can query whether the NS is successfully switched through this API. For details, see [Modifying DNS Servers](https://intl.cloud.tencent.com/document/product/1552/90452?from_cn_redirect=1).

error code that may be returned: 

INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
OPERATIONDENIED_RESOURCELOCKEDTEMPORARY = "OperationDenied.ResourceLockedTemporary"
RESOURCENOTFOUND = "ResourceNotFound"

func (*Client) VerifyOwnershipWithContext 

func (c *Client) VerifyOwnershipWithContext(ctx context.Context, request *VerifyOwnershipRequest) (response *VerifyOwnershipResponse, err error)

VerifyOwnership This API is used to verify your ownership of a site or domain name. It's required in the CNAME access mode. After a site is verified, you don't need to verify the ownership again for domain names added to it in the future. For details, see [Ownership Verification](https://intl.cloud.tencent.com/document/product/1552/70789?from_cn_redirect=1).

For sites connected via the NS, you can query whether the NS is successfully switched through this API. For details, see [Modifying DNS Servers](https://intl.cloud.tencent.com/document/product/1552/90452?from_cn_redirect=1).

error code that may be returned: 

INTERNALERROR_ROUTEERROR = "InternalError.RouteError"
OPERATIONDENIED_RESOURCELOCKEDTEMPORARY = "OperationDenied.ResourceLockedTemporary"
RESOURCENOTFOUND = "ResourceNotFound"

type ClientIpCountry 

type ClientIpCountry struct {
	// Whether to enable configuration. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// Name of the request header that contains the client IP region. It is valid when `Switch=on`.
	// The default value `EO-Client-IPCountry` is used when it is not specified.
	HeaderName *string `json:"HeaderName,omitnil,omitempty" name:"HeaderName"`
}

type ClientIpHeader 

type ClientIpHeader struct {
	// Whether to enable the configuration. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// Name of the request header containing the client IP address for origin-pull. When Switch is on, this parameter is required. X-Forwarded-For is not allowed for this parameter.
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	HeaderName *string `json:"HeaderName,omitnil,omitempty" name:"HeaderName"`
}

type CnameStatus 

type CnameStatus struct {
	// The domain name.
	RecordName *string `json:"RecordName,omitnil,omitempty" name:"RecordName"`

	// The CNAME address.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Cname *string `json:"Cname,omitnil,omitempty" name:"Cname"`

	// The CNAME status. Values:
	// <li>`active`: Activated</li>
	// <li>`moved`: Not activated </li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`
}

type CodeAction 

type CodeAction struct {
	// Feature name. For details, see [DescribeRulesSetting](https://intl.cloud.tencent.com/document/product/1552/80618?from_cn_redirect=1) API
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`

	// Operation parameter.
	Parameters []*RuleCodeActionParams `json:"Parameters,omitnil,omitempty" name:"Parameters"`
}

type Compression 

type Compression struct {
	// Whether to enable smart compression. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// Compression algorithm. Values:
	// <li>`brotli`: Brotli algorithm</li>
	// <li>`gzip`: Gzip algorithm</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	Algorithms []*string `json:"Algorithms,omitnil,omitempty" name:"Algorithms"`
}

type ConfigGroupVersionInfo 

type ConfigGroupVersionInfo struct {
	// Version ID.
	VersionId *string `json:"VersionId,omitnil,omitempty" name:"VersionId"`

	// Version No.
	VersionNumber *string `json:"VersionNumber,omitnil,omitempty" name:"VersionNumber"`

	// Configuraration group ID.
	GroupId *string `json:"GroupId,omitnil,omitempty" name:"GroupId"`

	// Configuration group type. Valid values:
	// <li>l7_acceleration: L7 acceleration configuration group. </li>
	// <li>edge_functions: Edge function configuration group. </li>
	GroupType *string `json:"GroupType,omitnil,omitempty" name:"GroupType"`

	// Version description.
	Description *string `json:"Description,omitnil,omitempty" name:"Description"`

	// Version status. Valid values:
	// <li>creating: Being created.</li>
	// <li>inactive: Not effective.</li>
	// <li>active: Effective. </li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// Version creation time. The time format follows the ISO 8601 standard and is represented in Coordinated Universal Time (UTC).
	CreateTime *string `json:"CreateTime,omitnil,omitempty" name:"CreateTime"`
}

type CreateAccelerationDomainRequest 

type CreateAccelerationDomainRequest struct {
	*tchttp.BaseRequest

	// ID of the site related with the acceleration domain name.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Acceleration domain name
	DomainName *string `json:"DomainName,omitnil,omitempty" name:"DomainName"`

	// Details of the origin.
	OriginInfo *OriginInfo `json:"OriginInfo,omitnil,omitempty" name:"OriginInfo"`

	// Origin-pull protocol configuration. Values:
	// <li>`FOLLOW`: Follow the protocol of origin</li>
	// <li>`HTTP`: Send requests to the origin over HTTP</li>
	// <li>`HTTPS`: Send requests to the origin over HTTPS</li>
	// <li>Default: `FOLLOW`</li>
	OriginProtocol *string `json:"OriginProtocol,omitnil,omitempty" name:"OriginProtocol"`

	// Ports for HTTP origin-pull requests. Range: 1-65535. It takes effect when `OriginProtocol=FOLLOW/HTTP`. Port 80 is used if it's not specified.
	HttpOriginPort *uint64 `json:"HttpOriginPort,omitnil,omitempty" name:"HttpOriginPort"`

	// Ports for HTTPS origin-pull requests. Range: 1-65535. It takes effect when `OriginProtocol=FOLLOW/HTTPS`. Port 443 is used if it's not specified.
	HttpsOriginPort *uint64 `json:"HttpsOriginPort,omitnil,omitempty" name:"HttpsOriginPort"`

	// IPv6 status. Values:
	// <li>`follow`: Follow the IPv6 configuration of the site</li>
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	// <li>Default: `follow`</li>
	IPv6Status *string `json:"IPv6Status,omitnil,omitempty" name:"IPv6Status"`
}

func NewCreateAccelerationDomainRequest 

func NewCreateAccelerationDomainRequest() (request *CreateAccelerationDomainRequest)

func (*CreateAccelerationDomainRequest) FromJsonString 

func (r *CreateAccelerationDomainRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateAccelerationDomainRequest) ToJsonString 

func (r *CreateAccelerationDomainRequest) ToJsonString() string

type CreateAccelerationDomainRequestParams 

type CreateAccelerationDomainRequestParams struct {
	// ID of the site related with the acceleration domain name.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Acceleration domain name
	DomainName *string `json:"DomainName,omitnil,omitempty" name:"DomainName"`

	// Details of the origin.
	OriginInfo *OriginInfo `json:"OriginInfo,omitnil,omitempty" name:"OriginInfo"`

	// Origin-pull protocol configuration. Values:
	// <li>`FOLLOW`: Follow the protocol of origin</li>
	// <li>`HTTP`: Send requests to the origin over HTTP</li>
	// <li>`HTTPS`: Send requests to the origin over HTTPS</li>
	// <li>Default: `FOLLOW`</li>
	OriginProtocol *string `json:"OriginProtocol,omitnil,omitempty" name:"OriginProtocol"`

	// Ports for HTTP origin-pull requests. Range: 1-65535. It takes effect when `OriginProtocol=FOLLOW/HTTP`. Port 80 is used if it's not specified.
	HttpOriginPort *uint64 `json:"HttpOriginPort,omitnil,omitempty" name:"HttpOriginPort"`

	// Ports for HTTPS origin-pull requests. Range: 1-65535. It takes effect when `OriginProtocol=FOLLOW/HTTPS`. Port 443 is used if it's not specified.
	HttpsOriginPort *uint64 `json:"HttpsOriginPort,omitnil,omitempty" name:"HttpsOriginPort"`

	// IPv6 status. Values:
	// <li>`follow`: Follow the IPv6 configuration of the site</li>
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	// <li>Default: `follow`</li>
	IPv6Status *string `json:"IPv6Status,omitnil,omitempty" name:"IPv6Status"`
}

Predefined struct for user

type CreateAccelerationDomainResponse 

type CreateAccelerationDomainResponse struct {
	*tchttp.BaseResponse
	Response *CreateAccelerationDomainResponseParams `json:"Response"`
}

func NewCreateAccelerationDomainResponse 

func NewCreateAccelerationDomainResponse() (response *CreateAccelerationDomainResponse)

func (*CreateAccelerationDomainResponse) FromJsonString 

func (r *CreateAccelerationDomainResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateAccelerationDomainResponse) ToJsonString 

func (r *CreateAccelerationDomainResponse) ToJsonString() string

type CreateAccelerationDomainResponseParams 

type CreateAccelerationDomainResponseParams struct {
	// Use the information returned by this parameter to verify the ownership of a domain name. For details, see [Ownership Verification](https://intl.cloud.tencent.com/document/product/1552/70789?from_cn_redirect=1).
	// Note: This field may return·null, indicating that no valid values can be obtained.
	OwnershipVerification *OwnershipVerification `json:"OwnershipVerification,omitnil,omitempty" name:"OwnershipVerification"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreateAliasDomainRequest 

type CreateAliasDomainRequest struct {
	*tchttp.BaseRequest

	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The alias domain name.
	AliasName *string `json:"AliasName,omitnil,omitempty" name:"AliasName"`

	// The target domain name.
	TargetName *string `json:"TargetName,omitnil,omitempty" name:"TargetName"`

	// Certificate configuration. Values:
	// <li>`none`: (Default) Do not configure</li>
	// <li>`hosting`: Managed SSL certificate</li>
	CertType *string `json:"CertType,omitnil,omitempty" name:"CertType"`

	// The certificate ID. This field is required when `CertType=hosting`.
	CertId []*string `json:"CertId,omitnil,omitempty" name:"CertId"`
}

func NewCreateAliasDomainRequest 

func NewCreateAliasDomainRequest() (request *CreateAliasDomainRequest)

func (*CreateAliasDomainRequest) FromJsonString 

func (r *CreateAliasDomainRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateAliasDomainRequest) ToJsonString 

func (r *CreateAliasDomainRequest) ToJsonString() string

type CreateAliasDomainRequestParams 

type CreateAliasDomainRequestParams struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The alias domain name.
	AliasName *string `json:"AliasName,omitnil,omitempty" name:"AliasName"`

	// The target domain name.
	TargetName *string `json:"TargetName,omitnil,omitempty" name:"TargetName"`

	// Certificate configuration. Values:
	// <li>`none`: (Default) Do not configure</li>
	// <li>`hosting`: Managed SSL certificate</li>
	CertType *string `json:"CertType,omitnil,omitempty" name:"CertType"`

	// The certificate ID. This field is required when `CertType=hosting`.
	CertId []*string `json:"CertId,omitnil,omitempty" name:"CertId"`
}

Predefined struct for user

type CreateAliasDomainResponse 

type CreateAliasDomainResponse struct {
	*tchttp.BaseResponse
	Response *CreateAliasDomainResponseParams `json:"Response"`
}

func NewCreateAliasDomainResponse 

func NewCreateAliasDomainResponse() (response *CreateAliasDomainResponse)

func (*CreateAliasDomainResponse) FromJsonString 

func (r *CreateAliasDomainResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateAliasDomainResponse) ToJsonString 

func (r *CreateAliasDomainResponse) ToJsonString() string

type CreateAliasDomainResponseParams 

type CreateAliasDomainResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreateApplicationProxyRequest 

type CreateApplicationProxyRequest struct {
	*tchttp.BaseRequest

	// Site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Domain name or subdomain name when `ProxyType=hostname`;
	// Instance name when `ProxyType=instance`.
	ProxyName *string `json:"ProxyName,omitnil,omitempty" name:"ProxyName"`

	// The scheduling mode. Values:
	// <li>`ip`: Schedule via Anycast IP.</li>
	// <li>`domain`: Schedule via CNAME.</li>
	PlatType *string `json:"PlatType,omitnil,omitempty" name:"PlatType"`

	// Whether to enable security protection. Values:
	// <li>`0`: Disable security protection.</li>
	// <li>`1`: Enable security protection.</li>
	SecurityType *int64 `json:"SecurityType,omitnil,omitempty" name:"SecurityType"`

	// Whether to enable acceleration. Values:
	// <li>`0`: Disable acceleration.</li>
	// <li>`1`: Enable acceleration.</li>
	AccelerateType *int64 `json:"AccelerateType,omitnil,omitempty" name:"AccelerateType"`

	// Layer 4 proxy mode, with value: <li>instance: instance mode.</li>If not specified, the default value instance will be used.
	ProxyType *string `json:"ProxyType,omitnil,omitempty" name:"ProxyType"`

	// The session persistence duration. Value range: 30-3600 (in seconds).
	// If not specified, this field uses the default value 600.
	SessionPersistTime *uint64 `json:"SessionPersistTime,omitnil,omitempty" name:"SessionPersistTime"`

	// Ipv6 access configuration.
	// IPv6 access is disabled if it is not specified.
	Ipv6 *Ipv6 `json:"Ipv6,omitnil,omitempty" name:"Ipv6"`

	// The rule details.
	// If this field is not specified, an application proxy rule will not be created.
	ApplicationProxyRules []*ApplicationProxyRule `json:"ApplicationProxyRules,omitnil,omitempty" name:"ApplicationProxyRules"`

	// Cross-MLC-border acceleration. It is disabled if this parameter is not specified.
	AccelerateMainland *AccelerateMainland `json:"AccelerateMainland,omitnil,omitempty" name:"AccelerateMainland"`
}

func NewCreateApplicationProxyRequest 

func NewCreateApplicationProxyRequest() (request *CreateApplicationProxyRequest)

func (*CreateApplicationProxyRequest) FromJsonString 

func (r *CreateApplicationProxyRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateApplicationProxyRequest) ToJsonString 

func (r *CreateApplicationProxyRequest) ToJsonString() string

type CreateApplicationProxyRequestParams 

type CreateApplicationProxyRequestParams struct {
	// Site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Domain name or subdomain name when `ProxyType=hostname`;
	// Instance name when `ProxyType=instance`.
	ProxyName *string `json:"ProxyName,omitnil,omitempty" name:"ProxyName"`

	// The scheduling mode. Values:
	// <li>`ip`: Schedule via Anycast IP.</li>
	// <li>`domain`: Schedule via CNAME.</li>
	PlatType *string `json:"PlatType,omitnil,omitempty" name:"PlatType"`

	// Whether to enable security protection. Values:
	// <li>`0`: Disable security protection.</li>
	// <li>`1`: Enable security protection.</li>
	SecurityType *int64 `json:"SecurityType,omitnil,omitempty" name:"SecurityType"`

	// Whether to enable acceleration. Values:
	// <li>`0`: Disable acceleration.</li>
	// <li>`1`: Enable acceleration.</li>
	AccelerateType *int64 `json:"AccelerateType,omitnil,omitempty" name:"AccelerateType"`

	// Layer 4 proxy mode, with value: <li>instance: instance mode.</li>If not specified, the default value instance will be used.
	ProxyType *string `json:"ProxyType,omitnil,omitempty" name:"ProxyType"`

	// The session persistence duration. Value range: 30-3600 (in seconds).
	// If not specified, this field uses the default value 600.
	SessionPersistTime *uint64 `json:"SessionPersistTime,omitnil,omitempty" name:"SessionPersistTime"`

	// Ipv6 access configuration.
	// IPv6 access is disabled if it is not specified.
	Ipv6 *Ipv6 `json:"Ipv6,omitnil,omitempty" name:"Ipv6"`

	// The rule details.
	// If this field is not specified, an application proxy rule will not be created.
	ApplicationProxyRules []*ApplicationProxyRule `json:"ApplicationProxyRules,omitnil,omitempty" name:"ApplicationProxyRules"`

	// Cross-MLC-border acceleration. It is disabled if this parameter is not specified.
	AccelerateMainland *AccelerateMainland `json:"AccelerateMainland,omitnil,omitempty" name:"AccelerateMainland"`
}

Predefined struct for user

type CreateApplicationProxyResponse 

type CreateApplicationProxyResponse struct {
	*tchttp.BaseResponse
	Response *CreateApplicationProxyResponseParams `json:"Response"`
}

func NewCreateApplicationProxyResponse 

func NewCreateApplicationProxyResponse() (response *CreateApplicationProxyResponse)

func (*CreateApplicationProxyResponse) FromJsonString 

func (r *CreateApplicationProxyResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateApplicationProxyResponse) ToJsonString 

func (r *CreateApplicationProxyResponse) ToJsonString() string

type CreateApplicationProxyResponseParams 

type CreateApplicationProxyResponseParams struct {
	// The L4 application proxy ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreateApplicationProxyRuleRequest 

type CreateApplicationProxyRuleRequest struct {
	*tchttp.BaseRequest

	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The proxy ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// The protocol. Values:
	// <li>`TCP`: TCP protocol</li>
	// <li>`UDP`: UDP protocol</li>
	Proto *string `json:"Proto,omitnil,omitempty" name:"Proto"`

	// The access port, which can be:
	// <li>A single port, such as 80</li>
	// <li>A port range, such as 81-90</li>
	Port []*string `json:"Port,omitnil,omitempty" name:"Port"`

	// Origin server type. Valid values:<li>custom: Manually added;</li>
	// <li>loadbalancer: Cloud Load Balancer;</li><li>origins: Origin server group.</li>
	OriginType *string `json:"OriginType,omitnil,omitempty" name:"OriginType"`

	// Details of the origin server:<li>When OriginType is custom, it indicates one or more origin servers, such as ["8.8.8.8","9.9.9.9"] or OriginValue=["test.com"];</li><li>When OriginType is loadbalancer, it indicates a single Cloud Load Balancer, such as ["lb-xdffsfasdfs"];</li><li>When OriginType is origins, it requires one and only one element, which represents an origin server group ID, such as ["origin-537f5b41-162a-11ed-abaa-525400c5da15"].</li>
	OriginValue []*string `json:"OriginValue,omitnil,omitempty" name:"OriginValue"`

	// Passes the client IP. Values:
	// <li>`TOA`: Pass the client IP via TOA (available only when `Proto=TCP`).</li>
	// <li>`PPV1`: Pass the client IP via Proxy Protocol V1 (available only when `Proto=TCP`).</li>
	// <li>`PPV2`: Pass the client IP via Proxy Protocol V2.</li>
	// <li>`OFF`: Not pass the client IP.</li>Default value: OFF.
	ForwardClientIp *string `json:"ForwardClientIp,omitnil,omitempty" name:"ForwardClientIp"`

	// Whether to enable session persistence. Values:
	// <li>`true`: Enable.</li>
	// <li>`false`: Disable.</li>Default value: false.
	SessionPersist *bool `json:"SessionPersist,omitnil,omitempty" name:"SessionPersist"`

	// Duration for the persistent session. The value takes effect only when `SessionPersist = true`.
	SessionPersistTime *uint64 `json:"SessionPersistTime,omitnil,omitempty" name:"SessionPersistTime"`

	// The origin port, which can be:
	// <li>A single port, such as 80</li>
	// <li>A port range, such as 81-82</li>
	OriginPort *string `json:"OriginPort,omitnil,omitempty" name:"OriginPort"`

	// Rule tag. This parameter is left empty by default.
	RuleTag *string `json:"RuleTag,omitnil,omitempty" name:"RuleTag"`
}

func NewCreateApplicationProxyRuleRequest 

func NewCreateApplicationProxyRuleRequest() (request *CreateApplicationProxyRuleRequest)

func (*CreateApplicationProxyRuleRequest) FromJsonString 

func (r *CreateApplicationProxyRuleRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateApplicationProxyRuleRequest) ToJsonString 

func (r *CreateApplicationProxyRuleRequest) ToJsonString() string

type CreateApplicationProxyRuleRequestParams 

type CreateApplicationProxyRuleRequestParams struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The proxy ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// The protocol. Values:
	// <li>`TCP`: TCP protocol</li>
	// <li>`UDP`: UDP protocol</li>
	Proto *string `json:"Proto,omitnil,omitempty" name:"Proto"`

	// The access port, which can be:
	// <li>A single port, such as 80</li>
	// <li>A port range, such as 81-90</li>
	Port []*string `json:"Port,omitnil,omitempty" name:"Port"`

	// Origin server type. Valid values:<li>custom: Manually added;</li>
	// <li>loadbalancer: Cloud Load Balancer;</li><li>origins: Origin server group.</li>
	OriginType *string `json:"OriginType,omitnil,omitempty" name:"OriginType"`

	// Details of the origin server:<li>When OriginType is custom, it indicates one or more origin servers, such as ["8.8.8.8","9.9.9.9"] or OriginValue=["test.com"];</li><li>When OriginType is loadbalancer, it indicates a single Cloud Load Balancer, such as ["lb-xdffsfasdfs"];</li><li>When OriginType is origins, it requires one and only one element, which represents an origin server group ID, such as ["origin-537f5b41-162a-11ed-abaa-525400c5da15"].</li>
	OriginValue []*string `json:"OriginValue,omitnil,omitempty" name:"OriginValue"`

	// Passes the client IP. Values:
	// <li>`TOA`: Pass the client IP via TOA (available only when `Proto=TCP`).</li>
	// <li>`PPV1`: Pass the client IP via Proxy Protocol V1 (available only when `Proto=TCP`).</li>
	// <li>`PPV2`: Pass the client IP via Proxy Protocol V2.</li>
	// <li>`OFF`: Not pass the client IP.</li>Default value: OFF.
	ForwardClientIp *string `json:"ForwardClientIp,omitnil,omitempty" name:"ForwardClientIp"`

	// Whether to enable session persistence. Values:
	// <li>`true`: Enable.</li>
	// <li>`false`: Disable.</li>Default value: false.
	SessionPersist *bool `json:"SessionPersist,omitnil,omitempty" name:"SessionPersist"`

	// Duration for the persistent session. The value takes effect only when `SessionPersist = true`.
	SessionPersistTime *uint64 `json:"SessionPersistTime,omitnil,omitempty" name:"SessionPersistTime"`

	// The origin port, which can be:
	// <li>A single port, such as 80</li>
	// <li>A port range, such as 81-82</li>
	OriginPort *string `json:"OriginPort,omitnil,omitempty" name:"OriginPort"`

	// Rule tag. This parameter is left empty by default.
	RuleTag *string `json:"RuleTag,omitnil,omitempty" name:"RuleTag"`
}

Predefined struct for user

type CreateApplicationProxyRuleResponse 

type CreateApplicationProxyRuleResponse struct {
	*tchttp.BaseResponse
	Response *CreateApplicationProxyRuleResponseParams `json:"Response"`
}

func NewCreateApplicationProxyRuleResponse 

func NewCreateApplicationProxyRuleResponse() (response *CreateApplicationProxyRuleResponse)

func (*CreateApplicationProxyRuleResponse) FromJsonString 

func (r *CreateApplicationProxyRuleResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateApplicationProxyRuleResponse) ToJsonString 

func (r *CreateApplicationProxyRuleResponse) ToJsonString() string

type CreateApplicationProxyRuleResponseParams 

type CreateApplicationProxyRuleResponseParams struct {
	// The rule ID.
	RuleId *string `json:"RuleId,omitnil,omitempty" name:"RuleId"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreateCLSIndexRequest 

type CreateCLSIndexRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The ID of the real-time log delivery task.
	TaskId *string `json:"TaskId,omitnil,omitempty" name:"TaskId"`
}

func NewCreateCLSIndexRequest 

func NewCreateCLSIndexRequest() (request *CreateCLSIndexRequest)

func (*CreateCLSIndexRequest) FromJsonString 

func (r *CreateCLSIndexRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateCLSIndexRequest) ToJsonString 

func (r *CreateCLSIndexRequest) ToJsonString() string

type CreateCLSIndexRequestParams 

type CreateCLSIndexRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The ID of the real-time log delivery task.
	TaskId *string `json:"TaskId,omitnil,omitempty" name:"TaskId"`
}

Predefined struct for user

type CreateCLSIndexResponse 

type CreateCLSIndexResponse struct {
	*tchttp.BaseResponse
	Response *CreateCLSIndexResponseParams `json:"Response"`
}

func NewCreateCLSIndexResponse 

func NewCreateCLSIndexResponse() (response *CreateCLSIndexResponse)

func (*CreateCLSIndexResponse) FromJsonString 

func (r *CreateCLSIndexResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateCLSIndexResponse) ToJsonString 

func (r *CreateCLSIndexResponse) ToJsonString() string

type CreateCLSIndexResponseParams 

type CreateCLSIndexResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreateConfigGroupVersionRequest 

type CreateConfigGroupVersionRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// GroupId of the version to be created.
	GroupId *string `json:"GroupId,omitnil,omitempty" name:"GroupId"`

	// Configuration content to be imported. It is required to be in JSON format and encoded in UTF-8. Please refer to the example below for the configuration file content.
	Content *string `json:"Content,omitnil,omitempty" name:"Content"`

	// Version description. The maximum length allowed is 50 characters. This field can be used to provide details about the application scenarios of this version.
	Description *string `json:"Description,omitnil,omitempty" name:"Description"`
}

func NewCreateConfigGroupVersionRequest 

func NewCreateConfigGroupVersionRequest() (request *CreateConfigGroupVersionRequest)

func (*CreateConfigGroupVersionRequest) FromJsonString 

func (r *CreateConfigGroupVersionRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateConfigGroupVersionRequest) ToJsonString 

func (r *CreateConfigGroupVersionRequest) ToJsonString() string

type CreateConfigGroupVersionRequestParams 

type CreateConfigGroupVersionRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// GroupId of the version to be created.
	GroupId *string `json:"GroupId,omitnil,omitempty" name:"GroupId"`

	// Configuration content to be imported. It is required to be in JSON format and encoded in UTF-8. Please refer to the example below for the configuration file content.
	Content *string `json:"Content,omitnil,omitempty" name:"Content"`

	// Version description. The maximum length allowed is 50 characters. This field can be used to provide details about the application scenarios of this version.
	Description *string `json:"Description,omitnil,omitempty" name:"Description"`
}

Predefined struct for user

type CreateConfigGroupVersionResponse 

type CreateConfigGroupVersionResponse struct {
	*tchttp.BaseResponse
	Response *CreateConfigGroupVersionResponseParams `json:"Response"`
}

func NewCreateConfigGroupVersionResponse 

func NewCreateConfigGroupVersionResponse() (response *CreateConfigGroupVersionResponse)

func (*CreateConfigGroupVersionResponse) FromJsonString 

func (r *CreateConfigGroupVersionResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateConfigGroupVersionResponse) ToJsonString 

func (r *CreateConfigGroupVersionResponse) ToJsonString() string

type CreateConfigGroupVersionResponseParams 

type CreateConfigGroupVersionResponseParams struct {
	// Version ID.
	VersionId *string `json:"VersionId,omitnil,omitempty" name:"VersionId"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreateCustomizeErrorPageRequest 

type CreateCustomizeErrorPageRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Custom error page name. The name must be 2-30 characters long.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// Custom error page type, with values:<li>text/html; </li><li>application/json;</li><li>text/plain;</li><li>text/xml.</li>
	ContentType *string `json:"ContentType,omitnil,omitempty" name:"ContentType"`

	// Custom error page description, not exceeding 60 characters.
	Description *string `json:"Description,omitnil,omitempty" name:"Description"`

	// Custom error page content, not exceeding 2 KB.
	Content *string `json:"Content,omitnil,omitempty" name:"Content"`
}

func NewCreateCustomizeErrorPageRequest 

func NewCreateCustomizeErrorPageRequest() (request *CreateCustomizeErrorPageRequest)

func (*CreateCustomizeErrorPageRequest) FromJsonString 

func (r *CreateCustomizeErrorPageRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateCustomizeErrorPageRequest) ToJsonString 

func (r *CreateCustomizeErrorPageRequest) ToJsonString() string

type CreateCustomizeErrorPageRequestParams 

type CreateCustomizeErrorPageRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Custom error page name. The name must be 2-30 characters long.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// Custom error page type, with values:<li>text/html; </li><li>application/json;</li><li>text/plain;</li><li>text/xml.</li>
	ContentType *string `json:"ContentType,omitnil,omitempty" name:"ContentType"`

	// Custom error page description, not exceeding 60 characters.
	Description *string `json:"Description,omitnil,omitempty" name:"Description"`

	// Custom error page content, not exceeding 2 KB.
	Content *string `json:"Content,omitnil,omitempty" name:"Content"`
}

Predefined struct for user

type CreateCustomizeErrorPageResponse 

type CreateCustomizeErrorPageResponse struct {
	*tchttp.BaseResponse
	Response *CreateCustomizeErrorPageResponseParams `json:"Response"`
}

func NewCreateCustomizeErrorPageResponse 

func NewCreateCustomizeErrorPageResponse() (response *CreateCustomizeErrorPageResponse)

func (*CreateCustomizeErrorPageResponse) FromJsonString 

func (r *CreateCustomizeErrorPageResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateCustomizeErrorPageResponse) ToJsonString 

func (r *CreateCustomizeErrorPageResponse) ToJsonString() string

type CreateCustomizeErrorPageResponseParams 

type CreateCustomizeErrorPageResponseParams struct {
	// Page ID.
	PageId *string `json:"PageId,omitnil,omitempty" name:"PageId"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreateFunctionRequest 

type CreateFunctionRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Function name, which can contain up to 30 characters, including lowercase letters, digits, and hyphens. It should start and end with a digit or a letter.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// Function content, which currently only supports JavaScript code. Its maximum size is 5 MB.
	Content *string `json:"Content,omitnil,omitempty" name:"Content"`

	// Function description, which can contain up to 60 characters.
	Remark *string `json:"Remark,omitnil,omitempty" name:"Remark"`
}

func NewCreateFunctionRequest 

func NewCreateFunctionRequest() (request *CreateFunctionRequest)

func (*CreateFunctionRequest) FromJsonString 

func (r *CreateFunctionRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateFunctionRequest) ToJsonString 

func (r *CreateFunctionRequest) ToJsonString() string

type CreateFunctionRequestParams 

type CreateFunctionRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Function name, which can contain up to 30 characters, including lowercase letters, digits, and hyphens. It should start and end with a digit or a letter.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// Function content, which currently only supports JavaScript code. Its maximum size is 5 MB.
	Content *string `json:"Content,omitnil,omitempty" name:"Content"`

	// Function description, which can contain up to 60 characters.
	Remark *string `json:"Remark,omitnil,omitempty" name:"Remark"`
}

Predefined struct for user

type CreateFunctionResponse 

type CreateFunctionResponse struct {
	*tchttp.BaseResponse
	Response *CreateFunctionResponseParams `json:"Response"`
}

func NewCreateFunctionResponse 

func NewCreateFunctionResponse() (response *CreateFunctionResponse)

func (*CreateFunctionResponse) FromJsonString 

func (r *CreateFunctionResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateFunctionResponse) ToJsonString 

func (r *CreateFunctionResponse) ToJsonString() string

type CreateFunctionResponseParams 

type CreateFunctionResponseParams struct {
	// Function ID.
	FunctionId *string `json:"FunctionId,omitnil,omitempty" name:"FunctionId"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreateFunctionRuleRequest 

type CreateFunctionRuleRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Rule condition list. There is an OR relationship between different conditions of the same trigger rule.
	FunctionRuleConditions []*FunctionRuleCondition `json:"FunctionRuleConditions,omitnil,omitempty" name:"FunctionRuleConditions"`

	// Function ID, specifying a function executed when a trigger rule condition is met.
	FunctionId *string `json:"FunctionId,omitnil,omitempty" name:"FunctionId"`

	// Rule description, which can contain up to 60 characters.
	Remark *string `json:"Remark,omitnil,omitempty" name:"Remark"`
}

func NewCreateFunctionRuleRequest 

func NewCreateFunctionRuleRequest() (request *CreateFunctionRuleRequest)

func (*CreateFunctionRuleRequest) FromJsonString 

func (r *CreateFunctionRuleRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateFunctionRuleRequest) ToJsonString 

func (r *CreateFunctionRuleRequest) ToJsonString() string

type CreateFunctionRuleRequestParams 

type CreateFunctionRuleRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Rule condition list. There is an OR relationship between different conditions of the same trigger rule.
	FunctionRuleConditions []*FunctionRuleCondition `json:"FunctionRuleConditions,omitnil,omitempty" name:"FunctionRuleConditions"`

	// Function ID, specifying a function executed when a trigger rule condition is met.
	FunctionId *string `json:"FunctionId,omitnil,omitempty" name:"FunctionId"`

	// Rule description, which can contain up to 60 characters.
	Remark *string `json:"Remark,omitnil,omitempty" name:"Remark"`
}

Predefined struct for user

type CreateFunctionRuleResponse 

type CreateFunctionRuleResponse struct {
	*tchttp.BaseResponse
	Response *CreateFunctionRuleResponseParams `json:"Response"`
}

func NewCreateFunctionRuleResponse 

func NewCreateFunctionRuleResponse() (response *CreateFunctionRuleResponse)

func (*CreateFunctionRuleResponse) FromJsonString 

func (r *CreateFunctionRuleResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateFunctionRuleResponse) ToJsonString 

func (r *CreateFunctionRuleResponse) ToJsonString() string

type CreateFunctionRuleResponseParams 

type CreateFunctionRuleResponseParams struct {
	// Rule ID.
	RuleId *string `json:"RuleId,omitnil,omitempty" name:"RuleId"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreateL4ProxyRequest 

type CreateL4ProxyRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Name of the L4 proxy instance, which can contain 1-50 characters, including a-z, 0-9, and hyphens (-). However, hyphens (-) cannot be used individually or consecutively and should not be placed at the beginning or end of the name. Modification is not allowed after creation.
	ProxyName *string `json:"ProxyName,omitnil,omitempty" name:"ProxyName"`

	// Acceleration zone of the L4 proxy instance.
	// <li>mainland: Chinese mainland availability zone;</li>
	// <li>overseas: global availability zone (excluding the Chinese mainland);</li>
	// <li>global: global availability zone.</li>
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// Whether to enable IPv6 access. If this parameter is not input, the default value `off` is used. This configuration can be enabled only in certain acceleration zones and security protection configurations. For details, see [Creating an L4 Proxy Instance] (https://intl.cloud.tencent.com/document/product/1552/90025?from_cn_redirect=1). Valid values:
	// <li>on: Enable;</li>
	// <li>off: Disable.</li>
	//
	Ipv6 *string `json:"Ipv6,omitnil,omitempty" name:"Ipv6"`

	// Whether to enable static IP. If this parameter is not input, the default value `off` is used. This configuration can be enabled only in certain acceleration zones and security protection configurations. For details, see [Creating an L4 Proxy Instance] (https://intl.cloud.tencent.com/document/product/1552/90025?from_cn_redirect=1). Valid values:
	// <li>on: Enable;</li>
	// <li>off: Disable.</li>
	StaticIp *string `json:"StaticIp,omitnil,omitempty" name:"StaticIp"`

	// Whether to enable network optimization for the Chinese mainland. If this parameter is not input, the default value `off` is used. This configuration can be enabled only in certain acceleration zones and security protection configurations. For details, see [Creating an L4 Proxy Instance] (https://intl.cloud.tencent.com/document/product/1552/90025?from_cn_redirect=1). Valid values:
	// <li>on: Enable;</li>
	// <li>off: Disable.</li>
	AccelerateMainland *string `json:"AccelerateMainland,omitnil,omitempty" name:"AccelerateMainland"`

	// Configuration of L3/L4 DDoS protection. If this parameter is not input, the default platform protection option is used. For details, see [Exclusive DDoS Protection Usage] (https://intl.cloud.tencent.com/document/product/1552/95994?from_cn_redirect=1).
	DDosProtectionConfig *DDosProtectionConfig `json:"DDosProtectionConfig,omitnil,omitempty" name:"DDosProtectionConfig"`
}

func NewCreateL4ProxyRequest 

func NewCreateL4ProxyRequest() (request *CreateL4ProxyRequest)

func (*CreateL4ProxyRequest) FromJsonString 

func (r *CreateL4ProxyRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateL4ProxyRequest) ToJsonString 

func (r *CreateL4ProxyRequest) ToJsonString() string

type CreateL4ProxyRequestParams 

type CreateL4ProxyRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Name of the L4 proxy instance, which can contain 1-50 characters, including a-z, 0-9, and hyphens (-). However, hyphens (-) cannot be used individually or consecutively and should not be placed at the beginning or end of the name. Modification is not allowed after creation.
	ProxyName *string `json:"ProxyName,omitnil,omitempty" name:"ProxyName"`

	// Acceleration zone of the L4 proxy instance.
	// <li>mainland: Chinese mainland availability zone;</li>
	// <li>overseas: global availability zone (excluding the Chinese mainland);</li>
	// <li>global: global availability zone.</li>
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// Whether to enable IPv6 access. If this parameter is not input, the default value `off` is used. This configuration can be enabled only in certain acceleration zones and security protection configurations. For details, see [Creating an L4 Proxy Instance] (https://intl.cloud.tencent.com/document/product/1552/90025?from_cn_redirect=1). Valid values:
	// <li>on: Enable;</li>
	// <li>off: Disable.</li>
	//
	Ipv6 *string `json:"Ipv6,omitnil,omitempty" name:"Ipv6"`

	// Whether to enable static IP. If this parameter is not input, the default value `off` is used. This configuration can be enabled only in certain acceleration zones and security protection configurations. For details, see [Creating an L4 Proxy Instance] (https://intl.cloud.tencent.com/document/product/1552/90025?from_cn_redirect=1). Valid values:
	// <li>on: Enable;</li>
	// <li>off: Disable.</li>
	StaticIp *string `json:"StaticIp,omitnil,omitempty" name:"StaticIp"`

	// Whether to enable network optimization for the Chinese mainland. If this parameter is not input, the default value `off` is used. This configuration can be enabled only in certain acceleration zones and security protection configurations. For details, see [Creating an L4 Proxy Instance] (https://intl.cloud.tencent.com/document/product/1552/90025?from_cn_redirect=1). Valid values:
	// <li>on: Enable;</li>
	// <li>off: Disable.</li>
	AccelerateMainland *string `json:"AccelerateMainland,omitnil,omitempty" name:"AccelerateMainland"`

	// Configuration of L3/L4 DDoS protection. If this parameter is not input, the default platform protection option is used. For details, see [Exclusive DDoS Protection Usage] (https://intl.cloud.tencent.com/document/product/1552/95994?from_cn_redirect=1).
	DDosProtectionConfig *DDosProtectionConfig `json:"DDosProtectionConfig,omitnil,omitempty" name:"DDosProtectionConfig"`
}

Predefined struct for user

type CreateL4ProxyResponse 

type CreateL4ProxyResponse struct {
	*tchttp.BaseResponse
	Response *CreateL4ProxyResponseParams `json:"Response"`
}

func NewCreateL4ProxyResponse 

func NewCreateL4ProxyResponse() (response *CreateL4ProxyResponse)

func (*CreateL4ProxyResponse) FromJsonString 

func (r *CreateL4ProxyResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateL4ProxyResponse) ToJsonString 

func (r *CreateL4ProxyResponse) ToJsonString() string

type CreateL4ProxyResponseParams 

type CreateL4ProxyResponseParams struct {
	// L4 instance ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreateL4ProxyRulesRequest 

type CreateL4ProxyRulesRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Layer 4 proxy instance ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// List of forwarding rules. A single request supports up to 200 forwarding rules.
	// Note: When L4ProxyRule is used here, Protocol, PortRange, OriginType, OriginValue, and OriginPortRange are required fields; ClientIPPassThroughMode, SessionPersist, SessionPersistTime, and RuleTag are optional fields; do not fill in RuleId and Status.
	L4ProxyRules []*L4ProxyRule `json:"L4ProxyRules,omitnil,omitempty" name:"L4ProxyRules"`
}

func NewCreateL4ProxyRulesRequest 

func NewCreateL4ProxyRulesRequest() (request *CreateL4ProxyRulesRequest)

func (*CreateL4ProxyRulesRequest) FromJsonString 

func (r *CreateL4ProxyRulesRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateL4ProxyRulesRequest) ToJsonString 

func (r *CreateL4ProxyRulesRequest) ToJsonString() string

type CreateL4ProxyRulesRequestParams 

type CreateL4ProxyRulesRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Layer 4 proxy instance ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// List of forwarding rules. A single request supports up to 200 forwarding rules.
	// Note: When L4ProxyRule is used here, Protocol, PortRange, OriginType, OriginValue, and OriginPortRange are required fields; ClientIPPassThroughMode, SessionPersist, SessionPersistTime, and RuleTag are optional fields; do not fill in RuleId and Status.
	L4ProxyRules []*L4ProxyRule `json:"L4ProxyRules,omitnil,omitempty" name:"L4ProxyRules"`
}

Predefined struct for user

type CreateL4ProxyRulesResponse 

type CreateL4ProxyRulesResponse struct {
	*tchttp.BaseResponse
	Response *CreateL4ProxyRulesResponseParams `json:"Response"`
}

func NewCreateL4ProxyRulesResponse 

func NewCreateL4ProxyRulesResponse() (response *CreateL4ProxyRulesResponse)

func (*CreateL4ProxyRulesResponse) FromJsonString 

func (r *CreateL4ProxyRulesResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateL4ProxyRulesResponse) ToJsonString 

func (r *CreateL4ProxyRulesResponse) ToJsonString() string

type CreateL4ProxyRulesResponseParams 

type CreateL4ProxyRulesResponseParams struct {
	// IDs of newly added forwarding rules, returned as an array.
	L4ProxyRuleIds []*string `json:"L4ProxyRuleIds,omitnil,omitempty" name:"L4ProxyRuleIds"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreateLoadBalancerRequest 

type CreateLoadBalancerRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// LoadBalancer name, which can contain 1 to 200 characters, including a-z, A-Z, 0-9, underscores (_), and hyphens (-).
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// LoadBalancer type. Valid values:
	// <li>HTTP: HTTP-specific LoadBalancer. It supports adding HTTP-specific and general origin server groups. It can only be referenced by site acceleration services (such as domain name service and rule engine).</li>
	// <li>GENERAL: general LoadBalancer. It only supports adding general origin server groups. It can be referenced by site acceleration services (such as domain name service and rule engine) and Layer-4 proxy.</li>
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// List of origin server groups and their corresponding disaster recovery scheduling priorities. For details, refer to Sample Scenario in [Quickly Create Load Balancers](https://intl.cloud.tencent.com/document/product/1552/104223?from_cn_redirect=1).
	OriginGroups []*OriginGroupInLoadBalancer `json:"OriginGroups,omitnil,omitempty" name:"OriginGroups"`

	// Health check policy. For details, refer to [Health Check Policies](https://intl.cloud.tencent.com/document/product/1552/104228?from_cn_redirect=1). If left empty, health check is disabled by default.
	HealthChecker *HealthChecker `json:"HealthChecker,omitnil,omitempty" name:"HealthChecker"`

	// Traffic scheduling policy among origin server groups. Valid values:
	// <li>Priority: Perform failover according to priority.</li>The default value is Priority.
	SteeringPolicy *string `json:"SteeringPolicy,omitnil,omitempty" name:"SteeringPolicy"`

	// Request retry policy when access to an origin server fails. For details, refer to [Introduction to Request Retry Strategy](https://intl.cloud.tencent.com/document/product/1552/104227?from_cn_redirect=1). Valid values:
	// <li>OtherOriginGroup: After a single request fails, retry with another origin server within the next lower priority origin server group.</li>
	// <li>OtherRecordInOriginGroup: After a single request fails, retry with another origin server within the same origin server group.</li> The default value is OtherRecordInOriginGroup.
	FailoverPolicy *string `json:"FailoverPolicy,omitnil,omitempty" name:"FailoverPolicy"`
}

func NewCreateLoadBalancerRequest 

func NewCreateLoadBalancerRequest() (request *CreateLoadBalancerRequest)

func (*CreateLoadBalancerRequest) FromJsonString 

func (r *CreateLoadBalancerRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateLoadBalancerRequest) ToJsonString 

func (r *CreateLoadBalancerRequest) ToJsonString() string

type CreateLoadBalancerRequestParams 

type CreateLoadBalancerRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// LoadBalancer name, which can contain 1 to 200 characters, including a-z, A-Z, 0-9, underscores (_), and hyphens (-).
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// LoadBalancer type. Valid values:
	// <li>HTTP: HTTP-specific LoadBalancer. It supports adding HTTP-specific and general origin server groups. It can only be referenced by site acceleration services (such as domain name service and rule engine).</li>
	// <li>GENERAL: general LoadBalancer. It only supports adding general origin server groups. It can be referenced by site acceleration services (such as domain name service and rule engine) and Layer-4 proxy.</li>
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// List of origin server groups and their corresponding disaster recovery scheduling priorities. For details, refer to Sample Scenario in [Quickly Create Load Balancers](https://intl.cloud.tencent.com/document/product/1552/104223?from_cn_redirect=1).
	OriginGroups []*OriginGroupInLoadBalancer `json:"OriginGroups,omitnil,omitempty" name:"OriginGroups"`

	// Health check policy. For details, refer to [Health Check Policies](https://intl.cloud.tencent.com/document/product/1552/104228?from_cn_redirect=1). If left empty, health check is disabled by default.
	HealthChecker *HealthChecker `json:"HealthChecker,omitnil,omitempty" name:"HealthChecker"`

	// Traffic scheduling policy among origin server groups. Valid values:
	// <li>Priority: Perform failover according to priority.</li>The default value is Priority.
	SteeringPolicy *string `json:"SteeringPolicy,omitnil,omitempty" name:"SteeringPolicy"`

	// Request retry policy when access to an origin server fails. For details, refer to [Introduction to Request Retry Strategy](https://intl.cloud.tencent.com/document/product/1552/104227?from_cn_redirect=1). Valid values:
	// <li>OtherOriginGroup: After a single request fails, retry with another origin server within the next lower priority origin server group.</li>
	// <li>OtherRecordInOriginGroup: After a single request fails, retry with another origin server within the same origin server group.</li> The default value is OtherRecordInOriginGroup.
	FailoverPolicy *string `json:"FailoverPolicy,omitnil,omitempty" name:"FailoverPolicy"`
}

Predefined struct for user

type CreateLoadBalancerResponse 

type CreateLoadBalancerResponse struct {
	*tchttp.BaseResponse
	Response *CreateLoadBalancerResponseParams `json:"Response"`
}

func NewCreateLoadBalancerResponse 

func NewCreateLoadBalancerResponse() (response *CreateLoadBalancerResponse)

func (*CreateLoadBalancerResponse) FromJsonString 

func (r *CreateLoadBalancerResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateLoadBalancerResponse) ToJsonString 

func (r *CreateLoadBalancerResponse) ToJsonString() string

type CreateLoadBalancerResponseParams 

type CreateLoadBalancerResponseParams struct {
	// CLB instance ID.
	InstanceId *string `json:"InstanceId,omitnil,omitempty" name:"InstanceId"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreateOriginGroupRequest 

type CreateOriginGroupRequest struct {
	*tchttp.BaseRequest

	// Site ID
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Origin group name. It can contain 1 to 200 characters ([a-z], [A-Z], [0-9] and [_-]).
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// (Required) Origin group type. Values:
	// <li>`GENERAL`: General origin groups. It supports IPs and domain names. It can be referenced by DNS, Rule Engine, Layer 4 Proxy and General LoadBalancer. </li>
	// <li>`HTTP`: HTTP-specific origin groups. It supports IPs/domain names and object storage buckets. It can be referenced by acceleration domain names, rule engines and HTTP LoadBalancer. It cannot be referenced by L4 proxies. </li>
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// (Required) Origins in the origin group.
	Records []*OriginRecord `json:"Records,omitnil,omitempty" name:"Records"`

	// Host header used for origin-pull. It only works when `Type=HTTP`. The `HostHeader` specified in `RuleEngine` takes a higher priority over this configuration.
	HostHeader *string `json:"HostHeader,omitnil,omitempty" name:"HostHeader"`
}

func NewCreateOriginGroupRequest 

func NewCreateOriginGroupRequest() (request *CreateOriginGroupRequest)

func (*CreateOriginGroupRequest) FromJsonString 

func (r *CreateOriginGroupRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateOriginGroupRequest) ToJsonString 

func (r *CreateOriginGroupRequest) ToJsonString() string

type CreateOriginGroupRequestParams 

type CreateOriginGroupRequestParams struct {
	// Site ID
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Origin group name. It can contain 1 to 200 characters ([a-z], [A-Z], [0-9] and [_-]).
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// (Required) Origin group type. Values:
	// <li>`GENERAL`: General origin groups. It supports IPs and domain names. It can be referenced by DNS, Rule Engine, Layer 4 Proxy and General LoadBalancer. </li>
	// <li>`HTTP`: HTTP-specific origin groups. It supports IPs/domain names and object storage buckets. It can be referenced by acceleration domain names, rule engines and HTTP LoadBalancer. It cannot be referenced by L4 proxies. </li>
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// (Required) Origins in the origin group.
	Records []*OriginRecord `json:"Records,omitnil,omitempty" name:"Records"`

	// Host header used for origin-pull. It only works when `Type=HTTP`. The `HostHeader` specified in `RuleEngine` takes a higher priority over this configuration.
	HostHeader *string `json:"HostHeader,omitnil,omitempty" name:"HostHeader"`
}

Predefined struct for user

type CreateOriginGroupResponse 

type CreateOriginGroupResponse struct {
	*tchttp.BaseResponse
	Response *CreateOriginGroupResponseParams `json:"Response"`
}

func NewCreateOriginGroupResponse 

func NewCreateOriginGroupResponse() (response *CreateOriginGroupResponse)

func (*CreateOriginGroupResponse) FromJsonString 

func (r *CreateOriginGroupResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateOriginGroupResponse) ToJsonString 

func (r *CreateOriginGroupResponse) ToJsonString() string

type CreateOriginGroupResponseParams 

type CreateOriginGroupResponseParams struct {
	// The ID of the origin group.
	OriginGroupId *string `json:"OriginGroupId,omitnil,omitempty" name:"OriginGroupId"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreatePlanForZoneRequest 

type CreatePlanForZoneRequest struct {
	*tchttp.BaseRequest

	// ID of the site.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The plan option. Values:
	// <li>`sta`: Standard plan that supports content delivery network outside the Chinese mainland.</li>
	// <li>`sta_with_bot`: Standard plan that supports content delivery network outside the Chinese mainland and bot management.</li>
	// <li>`sta_cm`: Standard plan that supports content delivery network inside the Chinese mainland.</li>
	// <li>`sta_cm_with_bot`: Standard plan that supports content delivery network inside the Chinese mainland and bot management.</li>
	// <li>`sta_global`: Standard plan that supports content delivery network over the globe.</li>
	// <li>`sta_global_with_bot`: Standard plan that supports content delivery network over the globe and bot management.</li>
	// <li>`ent`: Enterprise plan that supports content delivery network outside the Chinese mainland.</li>
	// <li>`ent_with_bot`: Enterprise plan that supports content delivery network outside the Chinese mainland and bot management.</li>
	// <li>`ent_cm`: Enterprise plan that supports content delivery network inside the Chinese mainland.</li>
	// <li>`ent_cm_with_bot`: Enterprise plan that supports content delivery network inside the Chinese mainland and bot management.</li>
	// <li>`ent_global`: Enterprise plan that supports content delivery network over the globe.</li>
	// <li>`ent_global_with_bot`: Enterprise plan that supports content delivery network over the globe and bot management.</li>To get the available plan options for your account, view the output from <a href="https://intl.cloud.tencent.com/document/product/1552/80606?from_cn_redirect=1">DescribeAvailablePlans</a>.
	PlanType *string `json:"PlanType,omitnil,omitempty" name:"PlanType"`
}

func NewCreatePlanForZoneRequest 

func NewCreatePlanForZoneRequest() (request *CreatePlanForZoneRequest)

func (*CreatePlanForZoneRequest) FromJsonString 

func (r *CreatePlanForZoneRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreatePlanForZoneRequest) ToJsonString 

func (r *CreatePlanForZoneRequest) ToJsonString() string

type CreatePlanForZoneRequestParams 

type CreatePlanForZoneRequestParams struct {
	// ID of the site.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The plan option. Values:
	// <li>`sta`: Standard plan that supports content delivery network outside the Chinese mainland.</li>
	// <li>`sta_with_bot`: Standard plan that supports content delivery network outside the Chinese mainland and bot management.</li>
	// <li>`sta_cm`: Standard plan that supports content delivery network inside the Chinese mainland.</li>
	// <li>`sta_cm_with_bot`: Standard plan that supports content delivery network inside the Chinese mainland and bot management.</li>
	// <li>`sta_global`: Standard plan that supports content delivery network over the globe.</li>
	// <li>`sta_global_with_bot`: Standard plan that supports content delivery network over the globe and bot management.</li>
	// <li>`ent`: Enterprise plan that supports content delivery network outside the Chinese mainland.</li>
	// <li>`ent_with_bot`: Enterprise plan that supports content delivery network outside the Chinese mainland and bot management.</li>
	// <li>`ent_cm`: Enterprise plan that supports content delivery network inside the Chinese mainland.</li>
	// <li>`ent_cm_with_bot`: Enterprise plan that supports content delivery network inside the Chinese mainland and bot management.</li>
	// <li>`ent_global`: Enterprise plan that supports content delivery network over the globe.</li>
	// <li>`ent_global_with_bot`: Enterprise plan that supports content delivery network over the globe and bot management.</li>To get the available plan options for your account, view the output from <a href="https://intl.cloud.tencent.com/document/product/1552/80606?from_cn_redirect=1">DescribeAvailablePlans</a>.
	PlanType *string `json:"PlanType,omitnil,omitempty" name:"PlanType"`
}

Predefined struct for user

type CreatePlanForZoneResponse 

type CreatePlanForZoneResponse struct {
	*tchttp.BaseResponse
	Response *CreatePlanForZoneResponseParams `json:"Response"`
}

func NewCreatePlanForZoneResponse 

func NewCreatePlanForZoneResponse() (response *CreatePlanForZoneResponse)

func (*CreatePlanForZoneResponse) FromJsonString 

func (r *CreatePlanForZoneResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreatePlanForZoneResponse) ToJsonString 

func (r *CreatePlanForZoneResponse) ToJsonString() string

type CreatePlanForZoneResponseParams 

type CreatePlanForZoneResponseParams struct {
	// List of purchased resources.
	ResourceNames []*string `json:"ResourceNames,omitnil,omitempty" name:"ResourceNames"`

	// List or order numbers.
	DealNames []*string `json:"DealNames,omitnil,omitempty" name:"DealNames"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreatePlanRequest 

type CreatePlanRequest struct {
	*tchttp.BaseRequest

	// Type of the subscribed plan. Valid values: <li>personal: Personal plan in prepaid mode;</li><li>basic: Basic plan in prepaid mode;</li><li>standard: Standard plan in prepaid mode;</li><li>enterprise: Enterprise plan in pay-as-you-go mode.</li>When subscribing to a prepaid plan, please ensure that your account balance is sufficient. If the balance is insufficient, an order to be paid will be generated.
	// For an overview of billing, see [EdgeOne Billing Overview](https://intl.cloud.tencent.com/document/product/1552/94156?from_cn_redirect=1).
	// For differences between plans, refer to [EdgeOne Billing Plan Comparison](https://intl.cloud.tencent.com/document/product/1552/94165?from_cn_redirect=1).
	PlanType *string `json:"PlanType,omitnil,omitempty" name:"PlanType"`

	// Whether to automatically use a voucher. Valid values: <li>true: Yes;</li><li>false: No.</li>This parameter is valid only when PlanType is personal, basic, or standard.
	// If this field is not specified, the default value 'false' will be used.
	AutoUseVoucher *string `json:"AutoUseVoucher,omitnil,omitempty" name:"AutoUseVoucher"`

	// Parameters for subscribing to a prepaid plan. When PlanType is personal, basic, or standard, this parameter is optional and can be used to specify the subscription duration of the plan and enable auto-renewal.
	// If this field is not specified, the default plan duration is 1 month, with auto-renewal disabled.
	PrepaidPlanParam *PrepaidPlanParam `json:"PrepaidPlanParam,omitnil,omitempty" name:"PrepaidPlanParam"`
}

func NewCreatePlanRequest 

func NewCreatePlanRequest() (request *CreatePlanRequest)

func (*CreatePlanRequest) FromJsonString 

func (r *CreatePlanRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreatePlanRequest) ToJsonString 

func (r *CreatePlanRequest) ToJsonString() string

type CreatePlanRequestParams 

type CreatePlanRequestParams struct {
	// Type of the subscribed plan. Valid values: <li>personal: Personal plan in prepaid mode;</li><li>basic: Basic plan in prepaid mode;</li><li>standard: Standard plan in prepaid mode;</li><li>enterprise: Enterprise plan in pay-as-you-go mode.</li>When subscribing to a prepaid plan, please ensure that your account balance is sufficient. If the balance is insufficient, an order to be paid will be generated.
	// For an overview of billing, see [EdgeOne Billing Overview](https://intl.cloud.tencent.com/document/product/1552/94156?from_cn_redirect=1).
	// For differences between plans, refer to [EdgeOne Billing Plan Comparison](https://intl.cloud.tencent.com/document/product/1552/94165?from_cn_redirect=1).
	PlanType *string `json:"PlanType,omitnil,omitempty" name:"PlanType"`

	// Whether to automatically use a voucher. Valid values: <li>true: Yes;</li><li>false: No.</li>This parameter is valid only when PlanType is personal, basic, or standard.
	// If this field is not specified, the default value 'false' will be used.
	AutoUseVoucher *string `json:"AutoUseVoucher,omitnil,omitempty" name:"AutoUseVoucher"`

	// Parameters for subscribing to a prepaid plan. When PlanType is personal, basic, or standard, this parameter is optional and can be used to specify the subscription duration of the plan and enable auto-renewal.
	// If this field is not specified, the default plan duration is 1 month, with auto-renewal disabled.
	PrepaidPlanParam *PrepaidPlanParam `json:"PrepaidPlanParam,omitnil,omitempty" name:"PrepaidPlanParam"`
}

Predefined struct for user

type CreatePlanResponse 

type CreatePlanResponse struct {
	*tchttp.BaseResponse
	Response *CreatePlanResponseParams `json:"Response"`
}

func NewCreatePlanResponse 

func NewCreatePlanResponse() (response *CreatePlanResponse)

func (*CreatePlanResponse) FromJsonString 

func (r *CreatePlanResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreatePlanResponse) ToJsonString 

func (r *CreatePlanResponse) ToJsonString() string

type CreatePlanResponseParams 

type CreatePlanResponseParams struct {
	// Plan ID, formatted as edgeone-2unuvzjmmn2q.
	PlanId *string `json:"PlanId,omitnil,omitempty" name:"PlanId"`

	// Order number.
	DealName *string `json:"DealName,omitnil,omitempty" name:"DealName"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreatePrefetchTaskRequest 

type CreatePrefetchTaskRequest struct {
	*tchttp.BaseRequest

	// ID of the site.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// List of resources to be preheated. Each element format is similar to the following:
	// http://www.example.com/example.txt. The parameter value is currently required.
	// Note: The number of tasks that can be submitted is limited by the quota of a billing package. For details, see [Billing Overview] (https://intl.cloud.tencent.com/document/product/1552/77380?from_cn_redirect=1).
	Targets []*string `json:"Targets,omitnil,omitempty" name:"Targets"`

	// Whether to encode a URL according to RFC3986. Enable this field when the URL contains non-ASCII characters.
	EncodeUrl *bool `json:"EncodeUrl,omitnil,omitempty" name:"EncodeUrl"`

	// HTTP header information
	Headers []*Header `json:"Headers,omitnil,omitempty" name:"Headers"`
}

func NewCreatePrefetchTaskRequest 

func NewCreatePrefetchTaskRequest() (request *CreatePrefetchTaskRequest)

func (*CreatePrefetchTaskRequest) FromJsonString 

func (r *CreatePrefetchTaskRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreatePrefetchTaskRequest) ToJsonString 

func (r *CreatePrefetchTaskRequest) ToJsonString() string

type CreatePrefetchTaskRequestParams 

type CreatePrefetchTaskRequestParams struct {
	// ID of the site.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// List of resources to be preheated. Each element format is similar to the following:
	// http://www.example.com/example.txt. The parameter value is currently required.
	// Note: The number of tasks that can be submitted is limited by the quota of a billing package. For details, see [Billing Overview] (https://intl.cloud.tencent.com/document/product/1552/77380?from_cn_redirect=1).
	Targets []*string `json:"Targets,omitnil,omitempty" name:"Targets"`

	// Whether to encode a URL according to RFC3986. Enable this field when the URL contains non-ASCII characters.
	EncodeUrl *bool `json:"EncodeUrl,omitnil,omitempty" name:"EncodeUrl"`

	// HTTP header information
	Headers []*Header `json:"Headers,omitnil,omitempty" name:"Headers"`
}

Predefined struct for user

type CreatePrefetchTaskResponse 

type CreatePrefetchTaskResponse struct {
	*tchttp.BaseResponse
	Response *CreatePrefetchTaskResponseParams `json:"Response"`
}

func NewCreatePrefetchTaskResponse 

func NewCreatePrefetchTaskResponse() (response *CreatePrefetchTaskResponse)

func (*CreatePrefetchTaskResponse) FromJsonString 

func (r *CreatePrefetchTaskResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreatePrefetchTaskResponse) ToJsonString 

func (r *CreatePrefetchTaskResponse) ToJsonString() string

type CreatePrefetchTaskResponseParams 

type CreatePrefetchTaskResponseParams struct {
	// ID of the task.
	JobId *string `json:"JobId,omitnil,omitempty" name:"JobId"`

	// List of failed tasks.
	// Note: This field may return null, indicating that no valid values can be obtained.
	FailedList []*FailReason `json:"FailedList,omitnil,omitempty" name:"FailedList"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreatePurgeTaskRequest 

type CreatePurgeTaskRequest struct {
	*tchttp.BaseRequest

	// ID of the site.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Type of cache purging. Values:
	// <li>`purge_url`: Purge by the URL</li>
	// <li>`purge_prefix`: Purge by the directory</li>
	// <li>`purge_host`: Purge by the hostname</li>
	// <li>`purge_all`: Purge all caches</li>
	// <li>`purge_cache_tag`: Purge by the cache-tag </li>For more details, see [Cache Purge](https://intl.cloud.tencent.com/document/product/1552/70759?from_cn_redirect=1).
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// Node cache purge method, valid for directory, hostname, and all cache refreshes. Valid values: <li>invalidate: Refreshes only resources that were updated under the directory; </li><li>delete: Refreshes all node resources, regardless of whether they were updated. </li>Default value: invalidate.
	Method *string `json:"Method,omitnil,omitempty" name:"Method"`

	// List of resources for which cache is to be purged. Each element format depends on the cache purge type and you can refer to the API examples for details. <li>The number of tasks that can be submitted at a time is limited by the quota of a billing package. For details, see [Billing Overview] (https://intl.cloud.tencent.com/document/product/1552/77380?from_cn_redirect=1).</li>
	Targets []*string `json:"Targets,omitnil,omitempty" name:"Targets"`

	// Specifies whether to transcode non-ASCII URLs according to RFC3986.
	// Note that if it’s enabled, the purging is based on the converted URLs.
	EncodeUrl *bool `json:"EncodeUrl,omitnil,omitempty" name:"EncodeUrl"`

	// The information attached when the node cache purge type is set to purge_cache_tag.
	CacheTag *CacheTag `json:"CacheTag,omitnil,omitempty" name:"CacheTag"`
}

func NewCreatePurgeTaskRequest 

func NewCreatePurgeTaskRequest() (request *CreatePurgeTaskRequest)

func (*CreatePurgeTaskRequest) FromJsonString 

func (r *CreatePurgeTaskRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreatePurgeTaskRequest) ToJsonString 

func (r *CreatePurgeTaskRequest) ToJsonString() string

type CreatePurgeTaskRequestParams 

type CreatePurgeTaskRequestParams struct {
	// ID of the site.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Type of cache purging. Values:
	// <li>`purge_url`: Purge by the URL</li>
	// <li>`purge_prefix`: Purge by the directory</li>
	// <li>`purge_host`: Purge by the hostname</li>
	// <li>`purge_all`: Purge all caches</li>
	// <li>`purge_cache_tag`: Purge by the cache-tag </li>For more details, see [Cache Purge](https://intl.cloud.tencent.com/document/product/1552/70759?from_cn_redirect=1).
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// Node cache purge method, valid for directory, hostname, and all cache refreshes. Valid values: <li>invalidate: Refreshes only resources that were updated under the directory; </li><li>delete: Refreshes all node resources, regardless of whether they were updated. </li>Default value: invalidate.
	Method *string `json:"Method,omitnil,omitempty" name:"Method"`

	// List of resources for which cache is to be purged. Each element format depends on the cache purge type and you can refer to the API examples for details. <li>The number of tasks that can be submitted at a time is limited by the quota of a billing package. For details, see [Billing Overview] (https://intl.cloud.tencent.com/document/product/1552/77380?from_cn_redirect=1).</li>
	Targets []*string `json:"Targets,omitnil,omitempty" name:"Targets"`

	// Specifies whether to transcode non-ASCII URLs according to RFC3986.
	// Note that if it’s enabled, the purging is based on the converted URLs.
	//
	// Deprecated: EncodeUrl is deprecated.
	EncodeUrl *bool `json:"EncodeUrl,omitnil,omitempty" name:"EncodeUrl"`

	// The information attached when the node cache purge type is set to purge_cache_tag.
	CacheTag *CacheTag `json:"CacheTag,omitnil,omitempty" name:"CacheTag"`
}

Predefined struct for user

type CreatePurgeTaskResponse 

type CreatePurgeTaskResponse struct {
	*tchttp.BaseResponse
	Response *CreatePurgeTaskResponseParams `json:"Response"`
}

func NewCreatePurgeTaskResponse 

func NewCreatePurgeTaskResponse() (response *CreatePurgeTaskResponse)

func (*CreatePurgeTaskResponse) FromJsonString 

func (r *CreatePurgeTaskResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreatePurgeTaskResponse) ToJsonString 

func (r *CreatePurgeTaskResponse) ToJsonString() string

type CreatePurgeTaskResponseParams 

type CreatePurgeTaskResponseParams struct {
	// ID of the task.
	JobId *string `json:"JobId,omitnil,omitempty" name:"JobId"`

	// List of failed tasks and reasons.
	// Note: This field may return null, indicating that no valid values can be obtained.
	FailedList []*FailReason `json:"FailedList,omitnil,omitempty" name:"FailedList"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreateRealtimeLogDeliveryTaskRequest 

type CreateRealtimeLogDeliveryTaskRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Name of a real-time log delivery task, which can contain up to 200 characters, including digits, English letters, hyphens (-) and underscores (_).
	TaskName *string `json:"TaskName,omitnil,omitempty" name:"TaskName"`

	// Type of a real-time log delivery task. Valid values:
	// <li>cls: push to Tencent Cloud CLS;</li>
	// <li>custom_endpoint: push to a custom HTTP(S) address;</li>
	// <li>s3: push to an AWS S3-compatible bucket address.</li>
	TaskType *string `json:"TaskType,omitnil,omitempty" name:"TaskType"`

	// List of entities (L7 domain names or L4 proxy instances) corresponding to a real-time log delivery task. Valid value examples:
	// <li>L7 domain name: domain.example.com;</li>
	// <li>L4 proxy instance: sid-2s69eb5wcms7.</li>
	EntityList []*string `json:"EntityList,omitnil,omitempty" name:"EntityList"`

	// Dataset type. Valid values:
	// <li>domain: site acceleration logs;</li>
	// <li>application: L4 proxy logs;</li>
	// <li>web-rateLiming: rate limit and CC attack defense logs;</li>
	// <li>web-attack: managed rule logs;</li>
	// <li>web-rule: custom rule logs;</li>
	// <li>web-bot: Bot management logs.</li>
	LogType *string `json:"LogType,omitnil,omitempty" name:"LogType"`

	// Data area. Valid values:
	// <li>mainland: within the Chinese mainland;</li>
	// <li>overseas: global (excluding the Chinese mainland).</li>
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// List of predefined fields for delivery.
	Fields []*string `json:"Fields,omitnil,omitempty" name:"Fields"`

	// The list of custom fields for log delivery, which supports extracting specified content from HTTP request headers, response headers, cookies, and request bodies. Custom field names must be unique. The number of custom fields cannot exceed a maximum of 200. A single real-time log delivery task can configure up to 5 custom fields of the request body type. Currently, only site acceleration logs (LogType=domain) support custom fields.
	CustomFields []*CustomField `json:"CustomFields,omitnil,omitempty" name:"CustomFields"`

	// Filter criteria of log delivery. If this parameter is not specified, all logs will be shipped.
	DeliveryConditions []*DeliveryCondition `json:"DeliveryConditions,omitnil,omitempty" name:"DeliveryConditions"`

	// Sampling ratio in permille. Value range: 1-1000. For example, 605 indicates a sampling ratio of 60.5%. If this parameter is not specified, the sampling ratio is 100%.
	Sample *uint64 `json:"Sample,omitnil,omitempty" name:"Sample"`

	// Output format for log delivery. If this field is not specified, the default format is used, which works as follows:
	// <li>When TaskType is 'custom_endpoint', the default format is an array of JSON objects, with each JSON object representing a log entry;</li>
	// <li>When TaskType is 's3', the default format is JSON Lines;</li>Specifically, when TaskType is 'cls', the only allowed value for LogFormat.FormatType is 'json', and other parameters in LogFormat will be ignored. It is recommended not to transfer LogFormat.
	LogFormat *LogFormat `json:"LogFormat,omitnil,omitempty" name:"LogFormat"`

	// Configuration information of CLS. This parameter is required when TaskType is cls.
	CLS *CLSTopic `json:"CLS,omitnil,omitempty" name:"CLS"`

	// Configuration information of the custom HTTP service. This parameter is required when TaskType is custom_endpoint.
	CustomEndpoint *CustomEndpoint `json:"CustomEndpoint,omitnil,omitempty" name:"CustomEndpoint"`

	// Configuration information of the AWS S3-compatible bucket. This parameter is required when TaskType is s3.
	S3 *S3 `json:"S3,omitnil,omitempty" name:"S3"`
}

func NewCreateRealtimeLogDeliveryTaskRequest 

func NewCreateRealtimeLogDeliveryTaskRequest() (request *CreateRealtimeLogDeliveryTaskRequest)

func (*CreateRealtimeLogDeliveryTaskRequest) FromJsonString 

func (r *CreateRealtimeLogDeliveryTaskRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateRealtimeLogDeliveryTaskRequest) ToJsonString 

func (r *CreateRealtimeLogDeliveryTaskRequest) ToJsonString() string

type CreateRealtimeLogDeliveryTaskRequestParams 

type CreateRealtimeLogDeliveryTaskRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Name of a real-time log delivery task, which can contain up to 200 characters, including digits, English letters, hyphens (-) and underscores (_).
	TaskName *string `json:"TaskName,omitnil,omitempty" name:"TaskName"`

	// Type of a real-time log delivery task. Valid values:
	// <li>cls: push to Tencent Cloud CLS;</li>
	// <li>custom_endpoint: push to a custom HTTP(S) address;</li>
	// <li>s3: push to an AWS S3-compatible bucket address.</li>
	TaskType *string `json:"TaskType,omitnil,omitempty" name:"TaskType"`

	// List of entities (L7 domain names or L4 proxy instances) corresponding to a real-time log delivery task. Valid value examples:
	// <li>L7 domain name: domain.example.com;</li>
	// <li>L4 proxy instance: sid-2s69eb5wcms7.</li>
	EntityList []*string `json:"EntityList,omitnil,omitempty" name:"EntityList"`

	// Dataset type. Valid values:
	// <li>domain: site acceleration logs;</li>
	// <li>application: L4 proxy logs;</li>
	// <li>web-rateLiming: rate limit and CC attack defense logs;</li>
	// <li>web-attack: managed rule logs;</li>
	// <li>web-rule: custom rule logs;</li>
	// <li>web-bot: Bot management logs.</li>
	LogType *string `json:"LogType,omitnil,omitempty" name:"LogType"`

	// Data area. Valid values:
	// <li>mainland: within the Chinese mainland;</li>
	// <li>overseas: global (excluding the Chinese mainland).</li>
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// List of predefined fields for delivery.
	Fields []*string `json:"Fields,omitnil,omitempty" name:"Fields"`

	// The list of custom fields for log delivery, which supports extracting specified content from HTTP request headers, response headers, cookies, and request bodies. Custom field names must be unique. The number of custom fields cannot exceed a maximum of 200. A single real-time log delivery task can configure up to 5 custom fields of the request body type. Currently, only site acceleration logs (LogType=domain) support custom fields.
	CustomFields []*CustomField `json:"CustomFields,omitnil,omitempty" name:"CustomFields"`

	// Filter criteria of log delivery. If this parameter is not specified, all logs will be shipped.
	DeliveryConditions []*DeliveryCondition `json:"DeliveryConditions,omitnil,omitempty" name:"DeliveryConditions"`

	// Sampling ratio in permille. Value range: 1-1000. For example, 605 indicates a sampling ratio of 60.5%. If this parameter is not specified, the sampling ratio is 100%.
	Sample *uint64 `json:"Sample,omitnil,omitempty" name:"Sample"`

	// Output format for log delivery. If this field is not specified, the default format is used, which works as follows:
	// <li>When TaskType is 'custom_endpoint', the default format is an array of JSON objects, with each JSON object representing a log entry;</li>
	// <li>When TaskType is 's3', the default format is JSON Lines;</li>Specifically, when TaskType is 'cls', the only allowed value for LogFormat.FormatType is 'json', and other parameters in LogFormat will be ignored. It is recommended not to transfer LogFormat.
	LogFormat *LogFormat `json:"LogFormat,omitnil,omitempty" name:"LogFormat"`

	// Configuration information of CLS. This parameter is required when TaskType is cls.
	CLS *CLSTopic `json:"CLS,omitnil,omitempty" name:"CLS"`

	// Configuration information of the custom HTTP service. This parameter is required when TaskType is custom_endpoint.
	CustomEndpoint *CustomEndpoint `json:"CustomEndpoint,omitnil,omitempty" name:"CustomEndpoint"`

	// Configuration information of the AWS S3-compatible bucket. This parameter is required when TaskType is s3.
	S3 *S3 `json:"S3,omitnil,omitempty" name:"S3"`
}

Predefined struct for user

type CreateRealtimeLogDeliveryTaskResponse 

type CreateRealtimeLogDeliveryTaskResponse struct {
	*tchttp.BaseResponse
	Response *CreateRealtimeLogDeliveryTaskResponseParams `json:"Response"`
}

func NewCreateRealtimeLogDeliveryTaskResponse 

func NewCreateRealtimeLogDeliveryTaskResponse() (response *CreateRealtimeLogDeliveryTaskResponse)

func (*CreateRealtimeLogDeliveryTaskResponse) FromJsonString 

func (r *CreateRealtimeLogDeliveryTaskResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateRealtimeLogDeliveryTaskResponse) ToJsonString 

func (r *CreateRealtimeLogDeliveryTaskResponse) ToJsonString() string

type CreateRealtimeLogDeliveryTaskResponseParams 

type CreateRealtimeLogDeliveryTaskResponseParams struct {
	// ID of the successfully created task.
	TaskId *string `json:"TaskId,omitnil,omitempty" name:"TaskId"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreateRuleRequest 

type CreateRuleRequest struct {
	*tchttp.BaseRequest

	// ID of the site
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The rule name (1 to 255 characters)
	RuleName *string `json:"RuleName,omitnil,omitempty" name:"RuleName"`

	// Rule status. Values:
	// <li>`enable`: Enabled</li>
	// <li>`disable`: Disabled</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// The rule content.
	Rules []*Rule `json:"Rules,omitnil,omitempty" name:"Rules"`

	// Tag of the rule.
	Tags []*string `json:"Tags,omitnil,omitempty" name:"Tags"`
}

func NewCreateRuleRequest 

func NewCreateRuleRequest() (request *CreateRuleRequest)

func (*CreateRuleRequest) FromJsonString 

func (r *CreateRuleRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateRuleRequest) ToJsonString 

func (r *CreateRuleRequest) ToJsonString() string

type CreateRuleRequestParams 

type CreateRuleRequestParams struct {
	// ID of the site
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The rule name (1 to 255 characters)
	RuleName *string `json:"RuleName,omitnil,omitempty" name:"RuleName"`

	// Rule status. Values:
	// <li>`enable`: Enabled</li>
	// <li>`disable`: Disabled</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// The rule content.
	Rules []*Rule `json:"Rules,omitnil,omitempty" name:"Rules"`

	// Tag of the rule.
	Tags []*string `json:"Tags,omitnil,omitempty" name:"Tags"`
}

Predefined struct for user

type CreateRuleResponse 

type CreateRuleResponse struct {
	*tchttp.BaseResponse
	Response *CreateRuleResponseParams `json:"Response"`
}

func NewCreateRuleResponse 

func NewCreateRuleResponse() (response *CreateRuleResponse)

func (*CreateRuleResponse) FromJsonString 

func (r *CreateRuleResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateRuleResponse) ToJsonString 

func (r *CreateRuleResponse) ToJsonString() string

type CreateRuleResponseParams 

type CreateRuleResponseParams struct {
	// Rule ID
	RuleId *string `json:"RuleId,omitnil,omitempty" name:"RuleId"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreateSecurityIPGroupRequest 

type CreateSecurityIPGroupRequest struct {
	*tchttp.BaseRequest

	// Site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// IP group information.
	IPGroup *IPGroup `json:"IPGroup,omitnil,omitempty" name:"IPGroup"`
}

func NewCreateSecurityIPGroupRequest 

func NewCreateSecurityIPGroupRequest() (request *CreateSecurityIPGroupRequest)

func (*CreateSecurityIPGroupRequest) FromJsonString 

func (r *CreateSecurityIPGroupRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateSecurityIPGroupRequest) ToJsonString 

func (r *CreateSecurityIPGroupRequest) ToJsonString() string

type CreateSecurityIPGroupRequestParams 

type CreateSecurityIPGroupRequestParams struct {
	// Site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// IP group information.
	IPGroup *IPGroup `json:"IPGroup,omitnil,omitempty" name:"IPGroup"`
}

Predefined struct for user

type CreateSecurityIPGroupResponse 

type CreateSecurityIPGroupResponse struct {
	*tchttp.BaseResponse
	Response *CreateSecurityIPGroupResponseParams `json:"Response"`
}

func NewCreateSecurityIPGroupResponse 

func NewCreateSecurityIPGroupResponse() (response *CreateSecurityIPGroupResponse)

func (*CreateSecurityIPGroupResponse) FromJsonString 

func (r *CreateSecurityIPGroupResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateSecurityIPGroupResponse) ToJsonString 

func (r *CreateSecurityIPGroupResponse) ToJsonString() string

type CreateSecurityIPGroupResponseParams 

type CreateSecurityIPGroupResponseParams struct {
	// IP group ID.
	GroupId *int64 `json:"GroupId,omitnil,omitempty" name:"GroupId"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreateSharedCNAMERequest 

type CreateSharedCNAMERequest struct {
	*tchttp.BaseRequest

	// ID of the site to which the shared CNAME belongs.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Shared CNAME prefix. Enter a valid domain name prefix, such as "test-api" and "test-api.com". A maximum of 50 characters are allowed.
	//
	// Complete format of the shared CNAME: '<Custom prefix>+<A 12-character random string in ZoneId>+share.dnse[0-5].com'.
	//
	// For example, if the prefix is example.com, EdgeOne will create the shared CNAME: example.com.sai2ig51kaa5.share.dnse2.com.
	SharedCNAMEPrefix *string `json:"SharedCNAMEPrefix,omitnil,omitempty" name:"SharedCNAMEPrefix"`

	// Description. It supports 1-50 characters.
	Description *string `json:"Description,omitnil,omitempty" name:"Description"`
}

func NewCreateSharedCNAMERequest 

func NewCreateSharedCNAMERequest() (request *CreateSharedCNAMERequest)

func (*CreateSharedCNAMERequest) FromJsonString 

func (r *CreateSharedCNAMERequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateSharedCNAMERequest) ToJsonString 

func (r *CreateSharedCNAMERequest) ToJsonString() string

type CreateSharedCNAMERequestParams 

type CreateSharedCNAMERequestParams struct {
	// ID of the site to which the shared CNAME belongs.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Shared CNAME prefix. Enter a valid domain name prefix, such as "test-api" and "test-api.com". A maximum of 50 characters are allowed.
	//
	// Complete format of the shared CNAME: '<Custom prefix>+<A 12-character random string in ZoneId>+share.dnse[0-5].com'.
	//
	// For example, if the prefix is example.com, EdgeOne will create the shared CNAME: example.com.sai2ig51kaa5.share.dnse2.com.
	SharedCNAMEPrefix *string `json:"SharedCNAMEPrefix,omitnil,omitempty" name:"SharedCNAMEPrefix"`

	// Description. It supports 1-50 characters.
	Description *string `json:"Description,omitnil,omitempty" name:"Description"`
}

Predefined struct for user

type CreateSharedCNAMEResponse 

type CreateSharedCNAMEResponse struct {
	*tchttp.BaseResponse
	Response *CreateSharedCNAMEResponseParams `json:"Response"`
}

func NewCreateSharedCNAMEResponse 

func NewCreateSharedCNAMEResponse() (response *CreateSharedCNAMEResponse)

func (*CreateSharedCNAMEResponse) FromJsonString 

func (r *CreateSharedCNAMEResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateSharedCNAMEResponse) ToJsonString 

func (r *CreateSharedCNAMEResponse) ToJsonString() string

type CreateSharedCNAMEResponseParams 

type CreateSharedCNAMEResponseParams struct {
	// Shared CNAME. Format: '<Custom prefix>+<A 12-character random string in ZoneId>+share.dnse[0-5].com'.
	SharedCNAME *string `json:"SharedCNAME,omitnil,omitempty" name:"SharedCNAME"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CreateZoneRequest 

type CreateZoneRequest struct {
	*tchttp.BaseRequest

	// Site access type. If this parameter is not input, the default value `partial` is used. Valid values of this parameter are as follows:
	// <li>partial: CNAME access;</li>
	// <li>full: NS access;</li>
	// <li>noDomainAccess: access with no domain name.</li>
	// <li>dnsPodAccess: DNSPod hosted access. To use this access mode, your domain name should have been hosted on DNSPod.</li>
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// Site name. For sites connected via CNAME/NS, pass in the secondary domain name (example.com). Leave it blank if the site is connected without a domain name.
	ZoneName *string `json:"ZoneName,omitnil,omitempty" name:"ZoneName"`

	// The acceleration area of the L7 domain name when `Type` is `partial` or `full`. When Type is `noDomainAccess`, please leave it blank.
	// <li>`global`: Global AZs</li>
	// <li>`mainland`: AZs in the Chinese mainland</li>
	// <li>`overseas`: (Default) AZs outside the Chinese mainland </li>
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// ID of the plan to which you want to bind the site. If you don't have an EdgeOne plan, purchase one in the EdgeOne console.
	PlanId *string `json:"PlanId,omitnil,omitempty" name:"PlanId"`

	// The site alias. It allows up to 20 characters, including [0-9], [a-z], [A-Z] and [-_]. For details, see [Glossary](https://intl.cloud.tencent.com/document/product/1552/70202?from_cn_redirect=1). If you don't want to use it, just leave it blank.
	AliasZoneName *string `json:"AliasZoneName,omitnil,omitempty" name:"AliasZoneName"`

	// Tags of the site. To create tags, go to the [Tag Console](https://console.cloud.tencent.com/tag/taglist).
	Tags []*Tag `json:"Tags,omitnil,omitempty" name:"Tags"`

	// Whether to allow duplicate sites. Values:
	// <li>`true`: Duplicate sites are allowed.</li>
	// <li>`false`: Duplicate sites are not allowed.</li>If it is left empty, the default value `false` is used.
	AllowDuplicates *bool `json:"AllowDuplicates,omitnil,omitempty" name:"AllowDuplicates"`

	// Whether to skip scanning the existing DNS records of the site. Default value: false.
	JumpStart *bool `json:"JumpStart,omitnil,omitempty" name:"JumpStart"`
}

func NewCreateZoneRequest 

func NewCreateZoneRequest() (request *CreateZoneRequest)

func (*CreateZoneRequest) FromJsonString 

func (r *CreateZoneRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateZoneRequest) ToJsonString 

func (r *CreateZoneRequest) ToJsonString() string

type CreateZoneRequestParams 

type CreateZoneRequestParams struct {
	// Site access type. If this parameter is not input, the default value `partial` is used. Valid values of this parameter are as follows:
	// <li>partial: CNAME access;</li>
	// <li>full: NS access;</li>
	// <li>noDomainAccess: access with no domain name.</li>
	// <li>dnsPodAccess: DNSPod hosted access. To use this access mode, your domain name should have been hosted on DNSPod.</li>
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// Site name. For sites connected via CNAME/NS, pass in the secondary domain name (example.com). Leave it blank if the site is connected without a domain name.
	ZoneName *string `json:"ZoneName,omitnil,omitempty" name:"ZoneName"`

	// The acceleration area of the L7 domain name when `Type` is `partial` or `full`. When Type is `noDomainAccess`, please leave it blank.
	// <li>`global`: Global AZs</li>
	// <li>`mainland`: AZs in the Chinese mainland</li>
	// <li>`overseas`: (Default) AZs outside the Chinese mainland </li>
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// ID of the plan to which you want to bind the site. If you don't have an EdgeOne plan, purchase one in the EdgeOne console.
	PlanId *string `json:"PlanId,omitnil,omitempty" name:"PlanId"`

	// The site alias. It allows up to 20 characters, including [0-9], [a-z], [A-Z] and [-_]. For details, see [Glossary](https://intl.cloud.tencent.com/document/product/1552/70202?from_cn_redirect=1). If you don't want to use it, just leave it blank.
	AliasZoneName *string `json:"AliasZoneName,omitnil,omitempty" name:"AliasZoneName"`

	// Tags of the site. To create tags, go to the [Tag Console](https://console.cloud.tencent.com/tag/taglist).
	Tags []*Tag `json:"Tags,omitnil,omitempty" name:"Tags"`

	// Whether to allow duplicate sites. Values:
	// <li>`true`: Duplicate sites are allowed.</li>
	// <li>`false`: Duplicate sites are not allowed.</li>If it is left empty, the default value `false` is used.
	//
	// Deprecated: AllowDuplicates is deprecated.
	AllowDuplicates *bool `json:"AllowDuplicates,omitnil,omitempty" name:"AllowDuplicates"`

	// Whether to skip scanning the existing DNS records of the site. Default value: false.
	//
	// Deprecated: JumpStart is deprecated.
	JumpStart *bool `json:"JumpStart,omitnil,omitempty" name:"JumpStart"`
}

Predefined struct for user

type CreateZoneResponse 

type CreateZoneResponse struct {
	*tchttp.BaseResponse
	Response *CreateZoneResponseParams `json:"Response"`
}

func NewCreateZoneResponse 

func NewCreateZoneResponse() (response *CreateZoneResponse)

func (*CreateZoneResponse) FromJsonString 

func (r *CreateZoneResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*CreateZoneResponse) ToJsonString 

func (r *CreateZoneResponse) ToJsonString() string

type CreateZoneResponseParams 

type CreateZoneResponseParams struct {
	// Site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Site ownership verification information. After the site is created, you need to complete the ownership verification before the site can serve normally.
	//
	// If `Type=partial`, add TXT records to your DNS provider or add files to the root DNS server, and then call [VerifyOwnership]() to complete verification. For more information, see [Ownership Verification](https://intl.cloud.tencent.com/document/product/1552/70789?from_cn_redirect=1).
	//
	// If `Type = full`, switch the DNS server as instructed by [Modifying DNS Server](https://intl.cloud.tencent.com/document/product/1552/90452?from_cn_redirect=1). Then call [VerifyOwnership]() to check the result.
	//
	// If `Type = noDomainAccess`, leave it blank. No action is required.
	// Note: This field may return·null, indicating that no valid values can be obtained.
	OwnershipVerification *OwnershipVerification `json:"OwnershipVerification,omitnil,omitempty" name:"OwnershipVerification"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type CustomEndpoint 

type CustomEndpoint struct {
	// Address of the custom HTTP API for real-time log shipping. Currently, only HTTP and HTTPS protocols are supported.
	Url *string `json:"Url,omitnil,omitempty" name:"Url"`

	// Custom SecretId used for generating an encrypted signature. This parameter is required if the origin server needs authentication.
	AccessId *string `json:"AccessId,omitnil,omitempty" name:"AccessId"`

	// Custom SecretKey used for generating an encrypted signature. This parameter is required if the origin server needs authentication.
	AccessKey *string `json:"AccessKey,omitnil,omitempty" name:"AccessKey"`

	// Type of data compression. Valid values:<li>gzip: gzip compression.</li>If this parameter is not input, compression is disabled.
	CompressType *string `json:"CompressType,omitnil,omitempty" name:"CompressType"`

	// Type of the application layer protocol used in POST requests for log shipping. Valid values:
	// <li>http: HTTP protocol;</li>
	// <li>https: HTTPS protocol.</li>If this parameter is not input, the protocol type is parsed from the URL field.
	Protocol *string `json:"Protocol,omitnil,omitempty" name:"Protocol"`

	// Custom request header carried in log shipping. For a header carried by default in EdgeOne log pushing, such as Content-Type, the header value you input will overwrite the default value. The header value references a single variable ${batchSize} to obtain the number of log entries included in each POST request.
	Headers []*Header `json:"Headers,omitnil,omitempty" name:"Headers"`
}

type CustomErrorPage 

type CustomErrorPage struct {
	// Custom error page ID.
	PageId *string `json:"PageId,omitnil,omitempty" name:"PageId"`

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Custom error page name.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// Custom error page type.
	ContentType *string `json:"ContentType,omitnil,omitempty" name:"ContentType"`

	// Custom error page description.
	Description *string `json:"Description,omitnil,omitempty" name:"Description"`

	// Custom error page content.
	Content *string `json:"Content,omitnil,omitempty" name:"Content"`

	// Custom error page reference.
	References []*ErrorPageReference `json:"References,omitnil,omitempty" name:"References"`
}

type CustomField 

type CustomField struct {
	// Type of the custom log filed, which indicates extracting data from a specified position in HTTP requests and responses. Valid values:
	// <li>ReqHeader: Extract the value of a specified field from an HTTP request header;</li>
	// <li>RspHeader: Extract the value of a specified field from an HTTP response header;</li>
	// <li>Cookie: Extract the value of a specified field from a cookie;</li>
	// <li>ReqBody: Extract specified content from an HTTP request body using a Google RE2 regular expression.</li>
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// Enter the definition of the field value based on the field type (Name). This parameter is case-sensitive.
	// <li>When the field type is ReqHeader, RspHeader, or Cookie, enter the name of the parameter for which you need to extract the value, such as Accept-Language. You can enter 1-100 characters. The name should start with a letter, contain letters, digits, and hyphens (-) in the middle, and end with a letter or digit.</li>
	// <li>When the field type is ReqBody, enter the Google RE2 regular expression. The maximum length of the regular expression is 4 KB.</li>
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	Value *string `json:"Value,omitnil,omitempty" name:"Value"`

	// Indicates whether to deliver this field. If not filled in, this field will not be delivered.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Enabled *bool `json:"Enabled,omitnil,omitempty" name:"Enabled"`
}

type CustomizedHeader 

type CustomizedHeader struct {
	// Custom header key.
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	Key *string `json:"Key,omitnil,omitempty" name:"Key"`

	// Custom header value.
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	Value *string `json:"Value,omitnil,omitempty" name:"Value"`
}

type DDoS 

type DDoS struct {
	// Switch. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`
}

type DDoSAttackEvent 

type DDoSAttackEvent struct {
	// The event ID.
	EventId *string `json:"EventId,omitnil,omitempty" name:"EventId"`

	// The attack type.
	AttackType *string `json:"AttackType,omitnil,omitempty" name:"AttackType"`

	// The attack status.
	AttackStatus *int64 `json:"AttackStatus,omitnil,omitempty" name:"AttackStatus"`

	// The maximum attack bandwidth.
	AttackMaxBandWidth *int64 `json:"AttackMaxBandWidth,omitnil,omitempty" name:"AttackMaxBandWidth"`

	// The peak attack packet rate.
	AttackPacketMaxRate *int64 `json:"AttackPacketMaxRate,omitnil,omitempty" name:"AttackPacketMaxRate"`

	// The attack start time recorded in seconds.
	AttackStartTime *int64 `json:"AttackStartTime,omitnil,omitempty" name:"AttackStartTime"`

	// The attack end time recorded in seconds.
	AttackEndTime *int64 `json:"AttackEndTime,omitnil,omitempty" name:"AttackEndTime"`

	// The DDoS policy ID.
	// Note: This field may return `null`, indicating that no valid value was found.
	PolicyId *int64 `json:"PolicyId,omitnil,omitempty" name:"PolicyId"`

	// The site ID.
	// Note: This field may return `null`, indicating that no valid value was found.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Geolocation scope. Values:
	// <li>`overseas`: Regions outside the Chinese mainland</li>
	// <li>`mainland`: Chinese mainland</li>
	// Note: This field may return `null`, indicating that no valid value was found.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// The blocking time of a DDoS attack.
	// Note: This field may return `null`, indicating that no valid value was found.
	DDoSBlockData []*DDoSBlockData `json:"DDoSBlockData,omitnil,omitempty" name:"DDoSBlockData"`
}

type DDoSBlockData 

type DDoSBlockData struct {
	// The start time recorded in UNIX timestamp.
	StartTime *int64 `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// The end time recorded in UNIX timestamp. `0` indicates the blocking is ongoing.
	EndTime *int64 `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// The regions blocked.
	BlockArea *string `json:"BlockArea,omitnil,omitempty" name:"BlockArea"`
}

type DDosProtectionConfig 

type DDosProtectionConfig struct {
	// Dedicated anti-DDoS specifications in the Chinese mainland. For details, refer to [Dedicated Anti-DDoS Related Fees](https://intl.cloud.tencent.com/document/product/1552/94162?from_cn_redirect=1).
	// <li>PLATFORM: uses the default protection. Dedicated anti-DDoS is not enabled;</li>
	// <li>BASE30_MAX300: uses dedicated anti-DDoS, which provides 30 Gbps guaranteed protection bandwidth and up to 300 Gbps elastic protection bandwidth;</li>
	// <li>BASE60_MAX600: uses dedicated anti-DDoS, which provides 60 Gbps guaranteed protection bandwidth and up to 600 Gbps elastic protection bandwidth. </li>If this field is not specified, the default value 'PLATFORM' will be used.
	LevelMainland *string `json:"LevelMainland,omitnil,omitempty" name:"LevelMainland"`

	// Configuration of elastic protection bandwidth for exclusive DDoS protection in the Chinese mainland.Valid only when exclusive DDoS protection in the Chinese mainland is enabled (refer to the LevelMainland parameter configuration), and the value has the following limitations:<li>When exclusive DDoS protection is enabled in the Chinese mainland and the 30 Gbps baseline protection bandwidth is used (the LevelMainland parameter value is BASE30_MAX300): the value range is 30 to 300 in Gbps;</li><li>When exclusive DDoS protection is enabled in the Chinese mainland and the 60 Gbps baseline protection bandwidth is used (the LevelMainland parameter value is BASE60_MAX600): the value range is 60 to 600 in Gbps;</li><li>When the default protection of the platform is used (the LevelMainland parameter value is PLATFORM): configuration is not supported, and the value of this parameter is invalid.</li>
	MaxBandwidthMainland *uint64 `json:"MaxBandwidthMainland,omitnil,omitempty" name:"MaxBandwidthMainland"`

	// Dedicated anti-DDoS specifications in global regions (excluding the Chinese mainland).
	// <li>PLATFORM: uses the default protection. Dedicated anti-DDoS is not enabled;</li>
	// <li>ANYCAST300: uses dedicated anti-DDoS, which provides 300 Gbps protection bandwidth;</li>
	// <li>ANYCAST_ALLIN: uses dedicated anti-DDoS, which provides all available protection resources. </li>If this field is not specified, the default value 'PLATFORM' will be used.
	LevelOverseas *string `json:"LevelOverseas,omitnil,omitempty" name:"LevelOverseas"`
}

type DefaultServerCertInfo 

type DefaultServerCertInfo struct {
	// ID of the server certificate.
	// Note: This field may return null, indicating that no valid values can be obtained.
	CertId *string `json:"CertId,omitnil,omitempty" name:"CertId"`

	// Alias of the certificate.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Alias *string `json:"Alias,omitnil,omitempty" name:"Alias"`

	// Type of the certificate. Values:
	// <li>`default`: Default certificate;</li>
	// <li>`upload`: Custom certificate;</li>
	// <li>`managed`: Tencent Cloud-managed certificate.</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// Time when the certificate expires.
	// Note: This field may return null, indicating that no valid values can be obtained.
	ExpireTime *string `json:"ExpireTime,omitnil,omitempty" name:"ExpireTime"`

	// Time when the certificate takes effect.
	// Note: This field may return null, indicating that no valid values can be obtained.
	EffectiveTime *string `json:"EffectiveTime,omitnil,omitempty" name:"EffectiveTime"`

	// Common name of the certificate.
	// Note: This field may return null, indicating that no valid values can be obtained.
	CommonName *string `json:"CommonName,omitnil,omitempty" name:"CommonName"`

	// Domain names added to the SAN certificate.
	// Note: This field may return null, indicating that no valid values can be obtained.
	SubjectAltName []*string `json:"SubjectAltName,omitnil,omitempty" name:"SubjectAltName"`

	// Deployment status. Values:
	// <li>`processing`: Deployment in progress</li>
	// <li>`deployed`: Deployed</li>
	// <li>`failed`: Deployment failed</li>
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// Failure description
	// Note: This field may return null, indicating that no valid values can be obtained.
	Message *string `json:"Message,omitnil,omitempty" name:"Message"`

	// Certificate algorithm.
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	SignAlgo *string `json:"SignAlgo,omitnil,omitempty" name:"SignAlgo"`
}

type DeleteAccelerationDomainsRequest 

type DeleteAccelerationDomainsRequest struct {
	*tchttp.BaseRequest

	// ID of the site related with the accelerated domain name.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// List of accelerated domain names to be deleted.
	DomainNames []*string `json:"DomainNames,omitnil,omitempty" name:"DomainNames"`

	// Whether to forcibly delete a domain name if it is associated with resources (such as alias domain names and traffic scheduling policies).
	// <li>`true`: Delete the domain name and all associated resources.</li>
	// <li>`false`: Do not delete the domain name and all associated resources.</li>If it’s not specified, the default value `false` is used.
	Force *bool `json:"Force,omitnil,omitempty" name:"Force"`
}

func NewDeleteAccelerationDomainsRequest 

func NewDeleteAccelerationDomainsRequest() (request *DeleteAccelerationDomainsRequest)

func (*DeleteAccelerationDomainsRequest) FromJsonString 

func (r *DeleteAccelerationDomainsRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteAccelerationDomainsRequest) ToJsonString 

func (r *DeleteAccelerationDomainsRequest) ToJsonString() string

type DeleteAccelerationDomainsRequestParams 

type DeleteAccelerationDomainsRequestParams struct {
	// ID of the site related with the accelerated domain name.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// List of accelerated domain names to be deleted.
	DomainNames []*string `json:"DomainNames,omitnil,omitempty" name:"DomainNames"`

	// Whether to forcibly delete a domain name if it is associated with resources (such as alias domain names and traffic scheduling policies).
	// <li>`true`: Delete the domain name and all associated resources.</li>
	// <li>`false`: Do not delete the domain name and all associated resources.</li>If it’s not specified, the default value `false` is used.
	Force *bool `json:"Force,omitnil,omitempty" name:"Force"`
}

Predefined struct for user

type DeleteAccelerationDomainsResponse 

type DeleteAccelerationDomainsResponse struct {
	*tchttp.BaseResponse
	Response *DeleteAccelerationDomainsResponseParams `json:"Response"`
}

func NewDeleteAccelerationDomainsResponse 

func NewDeleteAccelerationDomainsResponse() (response *DeleteAccelerationDomainsResponse)

func (*DeleteAccelerationDomainsResponse) FromJsonString 

func (r *DeleteAccelerationDomainsResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteAccelerationDomainsResponse) ToJsonString 

func (r *DeleteAccelerationDomainsResponse) ToJsonString() string

type DeleteAccelerationDomainsResponseParams 

type DeleteAccelerationDomainsResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DeleteAliasDomainRequest 

type DeleteAliasDomainRequest struct {
	*tchttp.BaseRequest

	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The alias domain name to be deleted. If it is left empty, the delete operation is not performed.
	AliasNames []*string `json:"AliasNames,omitnil,omitempty" name:"AliasNames"`
}

func NewDeleteAliasDomainRequest 

func NewDeleteAliasDomainRequest() (request *DeleteAliasDomainRequest)

func (*DeleteAliasDomainRequest) FromJsonString 

func (r *DeleteAliasDomainRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteAliasDomainRequest) ToJsonString 

func (r *DeleteAliasDomainRequest) ToJsonString() string

type DeleteAliasDomainRequestParams 

type DeleteAliasDomainRequestParams struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The alias domain name to be deleted. If it is left empty, the delete operation is not performed.
	AliasNames []*string `json:"AliasNames,omitnil,omitempty" name:"AliasNames"`
}

Predefined struct for user

type DeleteAliasDomainResponse 

type DeleteAliasDomainResponse struct {
	*tchttp.BaseResponse
	Response *DeleteAliasDomainResponseParams `json:"Response"`
}

func NewDeleteAliasDomainResponse 

func NewDeleteAliasDomainResponse() (response *DeleteAliasDomainResponse)

func (*DeleteAliasDomainResponse) FromJsonString 

func (r *DeleteAliasDomainResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteAliasDomainResponse) ToJsonString 

func (r *DeleteAliasDomainResponse) ToJsonString() string

type DeleteAliasDomainResponseParams 

type DeleteAliasDomainResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DeleteApplicationProxyRequest 

type DeleteApplicationProxyRequest struct {
	*tchttp.BaseRequest

	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The proxy ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`
}

func NewDeleteApplicationProxyRequest 

func NewDeleteApplicationProxyRequest() (request *DeleteApplicationProxyRequest)

func (*DeleteApplicationProxyRequest) FromJsonString 

func (r *DeleteApplicationProxyRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteApplicationProxyRequest) ToJsonString 

func (r *DeleteApplicationProxyRequest) ToJsonString() string

type DeleteApplicationProxyRequestParams 

type DeleteApplicationProxyRequestParams struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The proxy ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`
}

Predefined struct for user

type DeleteApplicationProxyResponse 

type DeleteApplicationProxyResponse struct {
	*tchttp.BaseResponse
	Response *DeleteApplicationProxyResponseParams `json:"Response"`
}

func NewDeleteApplicationProxyResponse 

func NewDeleteApplicationProxyResponse() (response *DeleteApplicationProxyResponse)

func (*DeleteApplicationProxyResponse) FromJsonString 

func (r *DeleteApplicationProxyResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteApplicationProxyResponse) ToJsonString 

func (r *DeleteApplicationProxyResponse) ToJsonString() string

type DeleteApplicationProxyResponseParams 

type DeleteApplicationProxyResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DeleteApplicationProxyRuleRequest 

type DeleteApplicationProxyRuleRequest struct {
	*tchttp.BaseRequest

	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The proxy ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// The rule ID.
	RuleId *string `json:"RuleId,omitnil,omitempty" name:"RuleId"`
}

func NewDeleteApplicationProxyRuleRequest 

func NewDeleteApplicationProxyRuleRequest() (request *DeleteApplicationProxyRuleRequest)

func (*DeleteApplicationProxyRuleRequest) FromJsonString 

func (r *DeleteApplicationProxyRuleRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteApplicationProxyRuleRequest) ToJsonString 

func (r *DeleteApplicationProxyRuleRequest) ToJsonString() string

type DeleteApplicationProxyRuleRequestParams 

type DeleteApplicationProxyRuleRequestParams struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The proxy ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// The rule ID.
	RuleId *string `json:"RuleId,omitnil,omitempty" name:"RuleId"`
}

Predefined struct for user

type DeleteApplicationProxyRuleResponse 

type DeleteApplicationProxyRuleResponse struct {
	*tchttp.BaseResponse
	Response *DeleteApplicationProxyRuleResponseParams `json:"Response"`
}

func NewDeleteApplicationProxyRuleResponse 

func NewDeleteApplicationProxyRuleResponse() (response *DeleteApplicationProxyRuleResponse)

func (*DeleteApplicationProxyRuleResponse) FromJsonString 

func (r *DeleteApplicationProxyRuleResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteApplicationProxyRuleResponse) ToJsonString 

func (r *DeleteApplicationProxyRuleResponse) ToJsonString() string

type DeleteApplicationProxyRuleResponseParams 

type DeleteApplicationProxyRuleResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DeleteCustomErrorPageRequest 

type DeleteCustomErrorPageRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Custom page ID.
	PageId *string `json:"PageId,omitnil,omitempty" name:"PageId"`
}

func NewDeleteCustomErrorPageRequest 

func NewDeleteCustomErrorPageRequest() (request *DeleteCustomErrorPageRequest)

func (*DeleteCustomErrorPageRequest) FromJsonString 

func (r *DeleteCustomErrorPageRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteCustomErrorPageRequest) ToJsonString 

func (r *DeleteCustomErrorPageRequest) ToJsonString() string

type DeleteCustomErrorPageRequestParams 

type DeleteCustomErrorPageRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Custom page ID.
	PageId *string `json:"PageId,omitnil,omitempty" name:"PageId"`
}

Predefined struct for user

type DeleteCustomErrorPageResponse 

type DeleteCustomErrorPageResponse struct {
	*tchttp.BaseResponse
	Response *DeleteCustomErrorPageResponseParams `json:"Response"`
}

func NewDeleteCustomErrorPageResponse 

func NewDeleteCustomErrorPageResponse() (response *DeleteCustomErrorPageResponse)

func (*DeleteCustomErrorPageResponse) FromJsonString 

func (r *DeleteCustomErrorPageResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteCustomErrorPageResponse) ToJsonString 

func (r *DeleteCustomErrorPageResponse) ToJsonString() string

type DeleteCustomErrorPageResponseParams 

type DeleteCustomErrorPageResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DeleteFunctionRequest 

type DeleteFunctionRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Function ID.
	FunctionId *string `json:"FunctionId,omitnil,omitempty" name:"FunctionId"`
}

func NewDeleteFunctionRequest 

func NewDeleteFunctionRequest() (request *DeleteFunctionRequest)

func (*DeleteFunctionRequest) FromJsonString 

func (r *DeleteFunctionRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteFunctionRequest) ToJsonString 

func (r *DeleteFunctionRequest) ToJsonString() string

type DeleteFunctionRequestParams 

type DeleteFunctionRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Function ID.
	FunctionId *string `json:"FunctionId,omitnil,omitempty" name:"FunctionId"`
}

Predefined struct for user

type DeleteFunctionResponse 

type DeleteFunctionResponse struct {
	*tchttp.BaseResponse
	Response *DeleteFunctionResponseParams `json:"Response"`
}

func NewDeleteFunctionResponse 

func NewDeleteFunctionResponse() (response *DeleteFunctionResponse)

func (*DeleteFunctionResponse) FromJsonString 

func (r *DeleteFunctionResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteFunctionResponse) ToJsonString 

func (r *DeleteFunctionResponse) ToJsonString() string

type DeleteFunctionResponseParams 

type DeleteFunctionResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DeleteFunctionRulesRequest 

type DeleteFunctionRulesRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Rule ID list.
	RuleIds []*string `json:"RuleIds,omitnil,omitempty" name:"RuleIds"`
}

func NewDeleteFunctionRulesRequest 

func NewDeleteFunctionRulesRequest() (request *DeleteFunctionRulesRequest)

func (*DeleteFunctionRulesRequest) FromJsonString 

func (r *DeleteFunctionRulesRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteFunctionRulesRequest) ToJsonString 

func (r *DeleteFunctionRulesRequest) ToJsonString() string

type DeleteFunctionRulesRequestParams 

type DeleteFunctionRulesRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Rule ID list.
	RuleIds []*string `json:"RuleIds,omitnil,omitempty" name:"RuleIds"`
}

Predefined struct for user

type DeleteFunctionRulesResponse 

type DeleteFunctionRulesResponse struct {
	*tchttp.BaseResponse
	Response *DeleteFunctionRulesResponseParams `json:"Response"`
}

func NewDeleteFunctionRulesResponse 

func NewDeleteFunctionRulesResponse() (response *DeleteFunctionRulesResponse)

func (*DeleteFunctionRulesResponse) FromJsonString 

func (r *DeleteFunctionRulesResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteFunctionRulesResponse) ToJsonString 

func (r *DeleteFunctionRulesResponse) ToJsonString() string

type DeleteFunctionRulesResponseParams 

type DeleteFunctionRulesResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DeleteL4ProxyRequest 

type DeleteL4ProxyRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Layer 4 proxy instance ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`
}

func NewDeleteL4ProxyRequest 

func NewDeleteL4ProxyRequest() (request *DeleteL4ProxyRequest)

func (*DeleteL4ProxyRequest) FromJsonString 

func (r *DeleteL4ProxyRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteL4ProxyRequest) ToJsonString 

func (r *DeleteL4ProxyRequest) ToJsonString() string

type DeleteL4ProxyRequestParams 

type DeleteL4ProxyRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Layer 4 proxy instance ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`
}

Predefined struct for user

type DeleteL4ProxyResponse 

type DeleteL4ProxyResponse struct {
	*tchttp.BaseResponse
	Response *DeleteL4ProxyResponseParams `json:"Response"`
}

func NewDeleteL4ProxyResponse 

func NewDeleteL4ProxyResponse() (response *DeleteL4ProxyResponse)

func (*DeleteL4ProxyResponse) FromJsonString 

func (r *DeleteL4ProxyResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteL4ProxyResponse) ToJsonString 

func (r *DeleteL4ProxyResponse) ToJsonString() string

type DeleteL4ProxyResponseParams 

type DeleteL4ProxyResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DeleteL4ProxyRulesRequest 

type DeleteL4ProxyRulesRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Layer 4 proxy instance ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// List of forwarding rule IDs. It supports up to 200 forwarding rules at a time.
	RuleIds []*string `json:"RuleIds,omitnil,omitempty" name:"RuleIds"`
}

func NewDeleteL4ProxyRulesRequest 

func NewDeleteL4ProxyRulesRequest() (request *DeleteL4ProxyRulesRequest)

func (*DeleteL4ProxyRulesRequest) FromJsonString 

func (r *DeleteL4ProxyRulesRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteL4ProxyRulesRequest) ToJsonString 

func (r *DeleteL4ProxyRulesRequest) ToJsonString() string

type DeleteL4ProxyRulesRequestParams 

type DeleteL4ProxyRulesRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Layer 4 proxy instance ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// List of forwarding rule IDs. It supports up to 200 forwarding rules at a time.
	RuleIds []*string `json:"RuleIds,omitnil,omitempty" name:"RuleIds"`
}

Predefined struct for user

type DeleteL4ProxyRulesResponse 

type DeleteL4ProxyRulesResponse struct {
	*tchttp.BaseResponse
	Response *DeleteL4ProxyRulesResponseParams `json:"Response"`
}

func NewDeleteL4ProxyRulesResponse 

func NewDeleteL4ProxyRulesResponse() (response *DeleteL4ProxyRulesResponse)

func (*DeleteL4ProxyRulesResponse) FromJsonString 

func (r *DeleteL4ProxyRulesResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteL4ProxyRulesResponse) ToJsonString 

func (r *DeleteL4ProxyRulesResponse) ToJsonString() string

type DeleteL4ProxyRulesResponseParams 

type DeleteL4ProxyRulesResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DeleteLoadBalancerRequest 

type DeleteLoadBalancerRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// CLB instance ID.
	InstanceId *string `json:"InstanceId,omitnil,omitempty" name:"InstanceId"`
}

func NewDeleteLoadBalancerRequest 

func NewDeleteLoadBalancerRequest() (request *DeleteLoadBalancerRequest)

func (*DeleteLoadBalancerRequest) FromJsonString 

func (r *DeleteLoadBalancerRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteLoadBalancerRequest) ToJsonString 

func (r *DeleteLoadBalancerRequest) ToJsonString() string

type DeleteLoadBalancerRequestParams 

type DeleteLoadBalancerRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// CLB instance ID.
	InstanceId *string `json:"InstanceId,omitnil,omitempty" name:"InstanceId"`
}

Predefined struct for user

type DeleteLoadBalancerResponse 

type DeleteLoadBalancerResponse struct {
	*tchttp.BaseResponse
	Response *DeleteLoadBalancerResponseParams `json:"Response"`
}

func NewDeleteLoadBalancerResponse 

func NewDeleteLoadBalancerResponse() (response *DeleteLoadBalancerResponse)

func (*DeleteLoadBalancerResponse) FromJsonString 

func (r *DeleteLoadBalancerResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteLoadBalancerResponse) ToJsonString 

func (r *DeleteLoadBalancerResponse) ToJsonString() string

type DeleteLoadBalancerResponseParams 

type DeleteLoadBalancerResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DeleteOriginGroupRequest 

type DeleteOriginGroupRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Origin server group ID. This parameter is required.
	GroupId *string `json:"GroupId,omitnil,omitempty" name:"GroupId"`
}

func NewDeleteOriginGroupRequest 

func NewDeleteOriginGroupRequest() (request *DeleteOriginGroupRequest)

func (*DeleteOriginGroupRequest) FromJsonString 

func (r *DeleteOriginGroupRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteOriginGroupRequest) ToJsonString 

func (r *DeleteOriginGroupRequest) ToJsonString() string

type DeleteOriginGroupRequestParams 

type DeleteOriginGroupRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Origin server group ID. This parameter is required.
	GroupId *string `json:"GroupId,omitnil,omitempty" name:"GroupId"`
}

Predefined struct for user

type DeleteOriginGroupResponse 

type DeleteOriginGroupResponse struct {
	*tchttp.BaseResponse
	Response *DeleteOriginGroupResponseParams `json:"Response"`
}

func NewDeleteOriginGroupResponse 

func NewDeleteOriginGroupResponse() (response *DeleteOriginGroupResponse)

func (*DeleteOriginGroupResponse) FromJsonString 

func (r *DeleteOriginGroupResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteOriginGroupResponse) ToJsonString 

func (r *DeleteOriginGroupResponse) ToJsonString() string

type DeleteOriginGroupResponseParams 

type DeleteOriginGroupResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DeleteRealtimeLogDeliveryTaskRequest 

type DeleteRealtimeLogDeliveryTaskRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The ID of the real-time log delivery task.
	TaskId *string `json:"TaskId,omitnil,omitempty" name:"TaskId"`
}

func NewDeleteRealtimeLogDeliveryTaskRequest 

func NewDeleteRealtimeLogDeliveryTaskRequest() (request *DeleteRealtimeLogDeliveryTaskRequest)

func (*DeleteRealtimeLogDeliveryTaskRequest) FromJsonString 

func (r *DeleteRealtimeLogDeliveryTaskRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteRealtimeLogDeliveryTaskRequest) ToJsonString 

func (r *DeleteRealtimeLogDeliveryTaskRequest) ToJsonString() string

type DeleteRealtimeLogDeliveryTaskRequestParams 

type DeleteRealtimeLogDeliveryTaskRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The ID of the real-time log delivery task.
	TaskId *string `json:"TaskId,omitnil,omitempty" name:"TaskId"`
}

Predefined struct for user

type DeleteRealtimeLogDeliveryTaskResponse 

type DeleteRealtimeLogDeliveryTaskResponse struct {
	*tchttp.BaseResponse
	Response *DeleteRealtimeLogDeliveryTaskResponseParams `json:"Response"`
}

func NewDeleteRealtimeLogDeliveryTaskResponse 

func NewDeleteRealtimeLogDeliveryTaskResponse() (response *DeleteRealtimeLogDeliveryTaskResponse)

func (*DeleteRealtimeLogDeliveryTaskResponse) FromJsonString 

func (r *DeleteRealtimeLogDeliveryTaskResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteRealtimeLogDeliveryTaskResponse) ToJsonString 

func (r *DeleteRealtimeLogDeliveryTaskResponse) ToJsonString() string

type DeleteRealtimeLogDeliveryTaskResponseParams 

type DeleteRealtimeLogDeliveryTaskResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DeleteRulesRequest 

type DeleteRulesRequest struct {
	*tchttp.BaseRequest

	// ID of the site
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// IDs of the rules to be deleted.
	RuleIds []*string `json:"RuleIds,omitnil,omitempty" name:"RuleIds"`
}

func NewDeleteRulesRequest 

func NewDeleteRulesRequest() (request *DeleteRulesRequest)

func (*DeleteRulesRequest) FromJsonString 

func (r *DeleteRulesRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteRulesRequest) ToJsonString 

func (r *DeleteRulesRequest) ToJsonString() string

type DeleteRulesRequestParams 

type DeleteRulesRequestParams struct {
	// ID of the site
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// IDs of the rules to be deleted.
	RuleIds []*string `json:"RuleIds,omitnil,omitempty" name:"RuleIds"`
}

Predefined struct for user

type DeleteRulesResponse 

type DeleteRulesResponse struct {
	*tchttp.BaseResponse
	Response *DeleteRulesResponseParams `json:"Response"`
}

func NewDeleteRulesResponse 

func NewDeleteRulesResponse() (response *DeleteRulesResponse)

func (*DeleteRulesResponse) FromJsonString 

func (r *DeleteRulesResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteRulesResponse) ToJsonString 

func (r *DeleteRulesResponse) ToJsonString() string

type DeleteRulesResponseParams 

type DeleteRulesResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DeleteSecurityIPGroupRequest 

type DeleteSecurityIPGroupRequest struct {
	*tchttp.BaseRequest

	// Site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// IP group ID.
	GroupId *int64 `json:"GroupId,omitnil,omitempty" name:"GroupId"`
}

func NewDeleteSecurityIPGroupRequest 

func NewDeleteSecurityIPGroupRequest() (request *DeleteSecurityIPGroupRequest)

func (*DeleteSecurityIPGroupRequest) FromJsonString 

func (r *DeleteSecurityIPGroupRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteSecurityIPGroupRequest) ToJsonString 

func (r *DeleteSecurityIPGroupRequest) ToJsonString() string

type DeleteSecurityIPGroupRequestParams 

type DeleteSecurityIPGroupRequestParams struct {
	// Site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// IP group ID.
	GroupId *int64 `json:"GroupId,omitnil,omitempty" name:"GroupId"`
}

Predefined struct for user

type DeleteSecurityIPGroupResponse 

type DeleteSecurityIPGroupResponse struct {
	*tchttp.BaseResponse
	Response *DeleteSecurityIPGroupResponseParams `json:"Response"`
}

func NewDeleteSecurityIPGroupResponse 

func NewDeleteSecurityIPGroupResponse() (response *DeleteSecurityIPGroupResponse)

func (*DeleteSecurityIPGroupResponse) FromJsonString 

func (r *DeleteSecurityIPGroupResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteSecurityIPGroupResponse) ToJsonString 

func (r *DeleteSecurityIPGroupResponse) ToJsonString() string

type DeleteSecurityIPGroupResponseParams 

type DeleteSecurityIPGroupResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DeleteSharedCNAMERequest 

type DeleteSharedCNAMERequest struct {
	*tchttp.BaseRequest

	// ID of the site to which the shared CNAME belongs.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The shared CNAME to be deleted
	SharedCNAME *string `json:"SharedCNAME,omitnil,omitempty" name:"SharedCNAME"`
}

func NewDeleteSharedCNAMERequest 

func NewDeleteSharedCNAMERequest() (request *DeleteSharedCNAMERequest)

func (*DeleteSharedCNAMERequest) FromJsonString 

func (r *DeleteSharedCNAMERequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteSharedCNAMERequest) ToJsonString 

func (r *DeleteSharedCNAMERequest) ToJsonString() string

type DeleteSharedCNAMERequestParams 

type DeleteSharedCNAMERequestParams struct {
	// ID of the site to which the shared CNAME belongs.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The shared CNAME to be deleted
	SharedCNAME *string `json:"SharedCNAME,omitnil,omitempty" name:"SharedCNAME"`
}

Predefined struct for user

type DeleteSharedCNAMEResponse 

type DeleteSharedCNAMEResponse struct {
	*tchttp.BaseResponse
	Response *DeleteSharedCNAMEResponseParams `json:"Response"`
}

func NewDeleteSharedCNAMEResponse 

func NewDeleteSharedCNAMEResponse() (response *DeleteSharedCNAMEResponse)

func (*DeleteSharedCNAMEResponse) FromJsonString 

func (r *DeleteSharedCNAMEResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteSharedCNAMEResponse) ToJsonString 

func (r *DeleteSharedCNAMEResponse) ToJsonString() string

type DeleteSharedCNAMEResponseParams 

type DeleteSharedCNAMEResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DeleteZoneRequest 

type DeleteZoneRequest struct {
	*tchttp.BaseRequest

	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`
}

func NewDeleteZoneRequest 

func NewDeleteZoneRequest() (request *DeleteZoneRequest)

func (*DeleteZoneRequest) FromJsonString 

func (r *DeleteZoneRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteZoneRequest) ToJsonString 

func (r *DeleteZoneRequest) ToJsonString() string

type DeleteZoneRequestParams 

type DeleteZoneRequestParams struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`
}

Predefined struct for user

type DeleteZoneResponse 

type DeleteZoneResponse struct {
	*tchttp.BaseResponse
	Response *DeleteZoneResponseParams `json:"Response"`
}

func NewDeleteZoneResponse 

func NewDeleteZoneResponse() (response *DeleteZoneResponse)

func (*DeleteZoneResponse) FromJsonString 

func (r *DeleteZoneResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeleteZoneResponse) ToJsonString 

func (r *DeleteZoneResponse) ToJsonString() string

type DeleteZoneResponseParams 

type DeleteZoneResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DeliveryCondition 

type DeliveryCondition struct {
	// Log filter criteria. The detailed filter criteria are as follows:
	// <li>EdgeResponseStatusCode: Filter by response status code returned from the EdgeOne node to the client.<br>?? Supported operators: equal, great, less, great_equal, less_equal<br>?? Valid values: any integer greater than or equal to 0</li>
	// <li>OriginResponseStatusCode: Filter by response status code of the origin server.<br>?? Supported operators: equal, great, less, great_equal, less_equal.<br>?? Valid values: any integer greater than or equal to -1</li>
	// <li>SecurityAction: Filter by final action after the request matches a security rule.<br>?? Supported operator: equal<br>?? Options:<br>?? -: unknown/not matched<br>?? Monitor: observation<br>?? JSChallenge: JavaScript challenge<br>?? Deny: blocking<br>?? Allow: allowing<br>?? BlockIP: IP blocking<br>?? Redirect: redirection<br>?? ReturnCustomPage: returning to a custom page<br>?? ManagedChallenge: managed challenge<br>?? Silence: silence<br>?? LongDelay: response after a long delay<br>?? ShortDelay: response after a short delay</li>
	// <li>SecurityModule: Filter by name of the security module finally handling the request.<br>??Supported operator: equal<br>??Options:<br>?? -: unknown/not matched<br>?? CustomRule: Custom Rules in Web Protection<br>?? RateLimitingCustomRule: Rate Limiting Rules in Web Protection<br>?? ManagedRule: Managed Rules in Web Protection<br>?? L7DDoS: CC Attack Defense in Web Protection<br>?? BotManagement: Bot Basic Management in Bot Management<br>?? BotClientReputation: Client Reputation Analysis in Bot Management<br>?? BotBehaviorAnalysis: Bot Intelligent Analysis in Bot Management<br>?? BotCustomRule: Custom Bot Rules in Bot Management<br>?? BotActiveDetection: Active Detection in Bot Management</li>
	Conditions []*QueryCondition `json:"Conditions,omitnil,omitempty" name:"Conditions"`
}

type DeployConfigGroupVersionRequest 

type DeployConfigGroupVersionRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Environment ID. Please specify the environment ID to which the version should be released.
	EnvId *string `json:"EnvId,omitnil,omitempty" name:"EnvId"`

	// Version information required for release. Multiple versions of different configuration groups can be modified simultaneously, while each group allows modifying only one version at a time.
	ConfigGroupVersionInfos []*ConfigGroupVersionInfo `json:"ConfigGroupVersionInfos,omitnil,omitempty" name:"ConfigGroupVersionInfos"`

	// Change description. It is used to describe the content and reasons for this change. A maximum of 100 characters are supported.
	Description *string `json:"Description,omitnil,omitempty" name:"Description"`
}

func NewDeployConfigGroupVersionRequest 

func NewDeployConfigGroupVersionRequest() (request *DeployConfigGroupVersionRequest)

func (*DeployConfigGroupVersionRequest) FromJsonString 

func (r *DeployConfigGroupVersionRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeployConfigGroupVersionRequest) ToJsonString 

func (r *DeployConfigGroupVersionRequest) ToJsonString() string

type DeployConfigGroupVersionRequestParams 

type DeployConfigGroupVersionRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Environment ID. Please specify the environment ID to which the version should be released.
	EnvId *string `json:"EnvId,omitnil,omitempty" name:"EnvId"`

	// Version information required for release. Multiple versions of different configuration groups can be modified simultaneously, while each group allows modifying only one version at a time.
	ConfigGroupVersionInfos []*ConfigGroupVersionInfo `json:"ConfigGroupVersionInfos,omitnil,omitempty" name:"ConfigGroupVersionInfos"`

	// Change description. It is used to describe the content and reasons for this change. A maximum of 100 characters are supported.
	Description *string `json:"Description,omitnil,omitempty" name:"Description"`
}

Predefined struct for user

type DeployConfigGroupVersionResponse 

type DeployConfigGroupVersionResponse struct {
	*tchttp.BaseResponse
	Response *DeployConfigGroupVersionResponseParams `json:"Response"`
}

func NewDeployConfigGroupVersionResponse 

func NewDeployConfigGroupVersionResponse() (response *DeployConfigGroupVersionResponse)

func (*DeployConfigGroupVersionResponse) FromJsonString 

func (r *DeployConfigGroupVersionResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DeployConfigGroupVersionResponse) ToJsonString 

func (r *DeployConfigGroupVersionResponse) ToJsonString() string

type DeployConfigGroupVersionResponseParams 

type DeployConfigGroupVersionResponseParams struct {
	// Release record ID.
	RecordId *string `json:"RecordId,omitnil,omitempty" name:"RecordId"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DeployRecord 

type DeployRecord struct {
	// Details about the released version.
	ConfigGroupVersionInfos []*ConfigGroupVersionInfo `json:"ConfigGroupVersionInfos,omitnil,omitempty" name:"ConfigGroupVersionInfos"`

	// Release time. The time format follows the ISO 8601 standard and is represented in Coordinated Universal Time (UTC).
	DeployTime *string `json:"DeployTime,omitnil,omitempty" name:"DeployTime"`

	// Release status. Valid values:
	// <li>deploying: Being released.</li>
	// <li>failure: Release failed.</li>
	// <li>success: Released successfully. </li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// Release result information.
	Message *string `json:"Message,omitnil,omitempty" name:"Message"`

	// Release record ID.
	// Note: this field may return null, indicating that no valid values can be obtained.
	RecordId *string `json:"RecordId,omitnil,omitempty" name:"RecordId"`

	// Change description.
	Description *string `json:"Description,omitnil,omitempty" name:"Description"`
}

type DescribeAccelerationDomainsRequest 

type DescribeAccelerationDomainsRequest struct {
	*tchttp.BaseRequest

	// ID of the site related with the acceleration domain name.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Offset for paginated queries. Default value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Limit on paginated queries. Default value: 20. Maximum value: 200.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter criteria. The maximum number of Filters.Values is 20. If this parameter is not input, all domain name information under the current zone-id will be returned. The detailed filter criteria are as follows:
	// <li>domain-name: Filter by acceleration domain name;</li>
	// <li>origin-type: Filter by origin server type;</li>
	// <li>origin: Filter by primary origin server address;</li>
	// <li>backup-origin: Filter by replica origin server address;</li>
	// <li>domain-cname: Filter by CNAME;</li>
	// <li>share-cname: Filter by shared CNAME.</li>
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`

	// Sort the returned results according to this field. Values include:
	// <li>`created_on`: Creation time of the acceleration domain name</li>
	// <li>`domain-name`: (Default) Acceleration domain name.</li>
	Order *string `json:"Order,omitnil,omitempty" name:"Order"`

	// Sort direction. If the field value is number, sort by the numeric value. If the field value is text, sort by the ascill code. Values include:
	// <li>`asc`: Ascending order.</li>
	// <li>`desc`: Descending order.</li> Default value: `asc`.
	Direction *string `json:"Direction,omitnil,omitempty" name:"Direction"`

	// The match mode. Values:
	// <li>`all`: Return all matches.</li>
	// <li>`any`: Return any match.</li>Default value: `all`.
	Match *string `json:"Match,omitnil,omitempty" name:"Match"`
}

func NewDescribeAccelerationDomainsRequest 

func NewDescribeAccelerationDomainsRequest() (request *DescribeAccelerationDomainsRequest)

func (*DescribeAccelerationDomainsRequest) FromJsonString 

func (r *DescribeAccelerationDomainsRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeAccelerationDomainsRequest) ToJsonString 

func (r *DescribeAccelerationDomainsRequest) ToJsonString() string

type DescribeAccelerationDomainsRequestParams 

type DescribeAccelerationDomainsRequestParams struct {
	// ID of the site related with the acceleration domain name.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Offset for paginated queries. Default value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Limit on paginated queries. Default value: 20. Maximum value: 200.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter criteria. The maximum number of Filters.Values is 20. If this parameter is not input, all domain name information under the current zone-id will be returned. The detailed filter criteria are as follows:
	// <li>domain-name: Filter by acceleration domain name;</li>
	// <li>origin-type: Filter by origin server type;</li>
	// <li>origin: Filter by primary origin server address;</li>
	// <li>backup-origin: Filter by replica origin server address;</li>
	// <li>domain-cname: Filter by CNAME;</li>
	// <li>share-cname: Filter by shared CNAME.</li>
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`

	// Sort the returned results according to this field. Values include:
	// <li>`created_on`: Creation time of the acceleration domain name</li>
	// <li>`domain-name`: (Default) Acceleration domain name.</li>
	Order *string `json:"Order,omitnil,omitempty" name:"Order"`

	// Sort direction. If the field value is number, sort by the numeric value. If the field value is text, sort by the ascill code. Values include:
	// <li>`asc`: Ascending order.</li>
	// <li>`desc`: Descending order.</li> Default value: `asc`.
	Direction *string `json:"Direction,omitnil,omitempty" name:"Direction"`

	// The match mode. Values:
	// <li>`all`: Return all matches.</li>
	// <li>`any`: Return any match.</li>Default value: `all`.
	Match *string `json:"Match,omitnil,omitempty" name:"Match"`
}

Predefined struct for user

type DescribeAccelerationDomainsResponse 

type DescribeAccelerationDomainsResponse struct {
	*tchttp.BaseResponse
	Response *DescribeAccelerationDomainsResponseParams `json:"Response"`
}

func NewDescribeAccelerationDomainsResponse 

func NewDescribeAccelerationDomainsResponse() (response *DescribeAccelerationDomainsResponse)

func (*DescribeAccelerationDomainsResponse) FromJsonString 

func (r *DescribeAccelerationDomainsResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeAccelerationDomainsResponse) ToJsonString 

func (r *DescribeAccelerationDomainsResponse) ToJsonString() string

type DescribeAccelerationDomainsResponseParams 

type DescribeAccelerationDomainsResponseParams struct {
	// Total of matched alias domain names.
	TotalCount *int64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// Information of all matched acceleration domain names
	AccelerationDomains []*AccelerationDomain `json:"AccelerationDomains,omitnil,omitempty" name:"AccelerationDomains"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeAliasDomainsRequest 

type DescribeAliasDomainsRequest struct {
	*tchttp.BaseRequest

	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The page offset. Default value: 0
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// The paginated query limit. Default value: 20. Maximum value: 1000.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter conditions. The maximum value for Filters.Values is 20. The detailed conditions are as follows:
	// <li>target-name: Filter by the target domain name;</li>
	// <li>alias-name: Filter by the alias of the domain name.</li>Fuzzy queries are only supported for the field name alias-name.
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

func NewDescribeAliasDomainsRequest 

func NewDescribeAliasDomainsRequest() (request *DescribeAliasDomainsRequest)

func (*DescribeAliasDomainsRequest) FromJsonString 

func (r *DescribeAliasDomainsRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeAliasDomainsRequest) ToJsonString 

func (r *DescribeAliasDomainsRequest) ToJsonString() string

type DescribeAliasDomainsRequestParams 

type DescribeAliasDomainsRequestParams struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The page offset. Default value: 0
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// The paginated query limit. Default value: 20. Maximum value: 1000.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter conditions. The maximum value for Filters.Values is 20. The detailed conditions are as follows:
	// <li>target-name: Filter by the target domain name;</li>
	// <li>alias-name: Filter by the alias of the domain name.</li>Fuzzy queries are only supported for the field name alias-name.
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

Predefined struct for user

type DescribeAliasDomainsResponse 

type DescribeAliasDomainsResponse struct {
	*tchttp.BaseResponse
	Response *DescribeAliasDomainsResponseParams `json:"Response"`
}

func NewDescribeAliasDomainsResponse 

func NewDescribeAliasDomainsResponse() (response *DescribeAliasDomainsResponse)

func (*DescribeAliasDomainsResponse) FromJsonString 

func (r *DescribeAliasDomainsResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeAliasDomainsResponse) ToJsonString 

func (r *DescribeAliasDomainsResponse) ToJsonString() string

type DescribeAliasDomainsResponseParams 

type DescribeAliasDomainsResponseParams struct {
	// Total eligible alias domain names.
	TotalCount *int64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// Information of the eligible alias domain names.
	AliasDomains []*AliasDomain `json:"AliasDomains,omitnil,omitempty" name:"AliasDomains"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeApplicationProxiesRequest 

type DescribeApplicationProxiesRequest struct {
	*tchttp.BaseRequest

	// Zone ID. This parameter is required.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Filters. Each filter can have up to 20 entries. Details: <li>proxy-id<br>   Filter by the <strong>Proxy ID</strong>, such as: `proxy-ev2sawbwfd`. <br>   Type: String<br>   Required: No</li><li>zone-id<br>   Filter by the <strong>Site ID</strong>, such as `zone-vawer2vadg`. <br>   Type: String<br>   Required: No</li><li>rule-tag<br>   Filter by the <strong>Rule tag</strong>, such as `rule-service-1`. <br>   Type: String<br>   Required: No</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`

	// The paginated query offset. Default value: 0
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// The paginated query limit. Default value: 20. Maximum value: 1000.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`
}

func NewDescribeApplicationProxiesRequest 

func NewDescribeApplicationProxiesRequest() (request *DescribeApplicationProxiesRequest)

func (*DescribeApplicationProxiesRequest) FromJsonString 

func (r *DescribeApplicationProxiesRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeApplicationProxiesRequest) ToJsonString 

func (r *DescribeApplicationProxiesRequest) ToJsonString() string

type DescribeApplicationProxiesRequestParams 

type DescribeApplicationProxiesRequestParams struct {
	// Zone ID. This parameter is required.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Filters. Each filter can have up to 20 entries. Details: <li>proxy-id<br>   Filter by the <strong>Proxy ID</strong>, such as: `proxy-ev2sawbwfd`. <br>   Type: String<br>   Required: No</li><li>zone-id<br>   Filter by the <strong>Site ID</strong>, such as `zone-vawer2vadg`. <br>   Type: String<br>   Required: No</li><li>rule-tag<br>   Filter by the <strong>Rule tag</strong>, such as `rule-service-1`. <br>   Type: String<br>   Required: No</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`

	// The paginated query offset. Default value: 0
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// The paginated query limit. Default value: 20. Maximum value: 1000.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`
}

Predefined struct for user

type DescribeApplicationProxiesResponse 

type DescribeApplicationProxiesResponse struct {
	*tchttp.BaseResponse
	Response *DescribeApplicationProxiesResponseParams `json:"Response"`
}

func NewDescribeApplicationProxiesResponse 

func NewDescribeApplicationProxiesResponse() (response *DescribeApplicationProxiesResponse)

func (*DescribeApplicationProxiesResponse) FromJsonString 

func (r *DescribeApplicationProxiesResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeApplicationProxiesResponse) ToJsonString 

func (r *DescribeApplicationProxiesResponse) ToJsonString() string

type DescribeApplicationProxiesResponseParams 

type DescribeApplicationProxiesResponseParams struct {
	// List of application proxies.
	ApplicationProxies []*ApplicationProxy `json:"ApplicationProxies,omitnil,omitempty" name:"ApplicationProxies"`

	// Total number of records.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeAvailablePlansRequest 

type DescribeAvailablePlansRequest struct {
	*tchttp.BaseRequest
}

func NewDescribeAvailablePlansRequest 

func NewDescribeAvailablePlansRequest() (request *DescribeAvailablePlansRequest)

func (*DescribeAvailablePlansRequest) FromJsonString 

func (r *DescribeAvailablePlansRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeAvailablePlansRequest) ToJsonString 

func (r *DescribeAvailablePlansRequest) ToJsonString() string

type DescribeAvailablePlansRequestParams 

type DescribeAvailablePlansRequestParams struct {
}

Predefined struct for user

type DescribeAvailablePlansResponse 

type DescribeAvailablePlansResponse struct {
	*tchttp.BaseResponse
	Response *DescribeAvailablePlansResponseParams `json:"Response"`
}

func NewDescribeAvailablePlansResponse 

func NewDescribeAvailablePlansResponse() (response *DescribeAvailablePlansResponse)

func (*DescribeAvailablePlansResponse) FromJsonString 

func (r *DescribeAvailablePlansResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeAvailablePlansResponse) ToJsonString 

func (r *DescribeAvailablePlansResponse) ToJsonString() string

type DescribeAvailablePlansResponseParams 

type DescribeAvailablePlansResponseParams struct {
	// Plans available for the current user
	// Note: This field may return null, indicating that no valid values can be obtained.
	PlanInfo []*PlanInfo `json:"PlanInfo,omitnil,omitempty" name:"PlanInfo"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeBillingDataRequest 

type DescribeBillingDataRequest struct {
	*tchttp.BaseRequest

	// Start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// End time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// Site ID set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// Metric list. Valid values:
	// <li>acc_flux: content acceleration traffic, in bytes;</li>
	// <li>smt_flux: smart acceleration traffic, in bytes;</li>
	// <li>l4_flux: L4 acceleration traffic, in bytes;</li>
	// <li>sec_flux: exclusive protection traffic, in bytes;</li>
	// <li>zxctg_flux: network optimization traffic in the Chinese mainland, in bytes;</li>
	// <li>acc_bandwidth: content acceleration bandwidth, in bps;</li>
	// <li>smt_bandwidth: smart acceleration bandwidth, in bps;</li>
	// <li>l4_bandwidth: L4 acceleration bandwidth, in bps;</li>
	// <li>sec_bandwidth: exclusive protection bandwidth, in bps;</li>
	// <li>zxctg_bandwidth: network optimization bandwidth in the Chinese mainland, in bps;</li>
	// <li>sec_request_clean: number of HTTP/HTTPS requests;</li>
	// <li>smt_request_clean: number of smart acceleration requests;</li>
	// <li>quic_request: number of QUIC requests;</li>
	// <li>bot_request_clean: number of Bot requests;</li>
	// <li>cls_count: number of real-time log entries pushed;</li>
	// <li>ddos_bandwidth: elastic DDoS protection bandwidth, in bps.</li>
	MetricName *string `json:"MetricName,omitnil,omitempty" name:"MetricName"`

	// Time granularity of the query. Valid values:
	// <li>5min: 5 minutes;</li>
	// <li>hour: 1 hour;</li>
	// <li>day: 1 day.</li>
	Interval *string `json:"Interval,omitnil,omitempty" name:"Interval"`

	// Filter criteria. The detailed values of filter criteria are as follows:
	// <li>host: Filter by domain name, such as test.example.com.<br></li>
	// <li>proxy-id: Filter by L4 proxy instance ID, such as sid-2rugn89bkla9.<br></li>
	// <li>region-id: Filter by billing region. Options:<br>  CH: Chinese mainland<br>  AF: Africa<br>  AS1: Asia-Pacific Region 1<br>  AS2: Asia-Pacific Region 2<br>  AS3: Asia-Pacific Region 3<br>  EU: Europe<br>  MidEast: Middle East<br>  NA: North America<br>  SA: South America</li>
	Filters []*BillingDataFilter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

func NewDescribeBillingDataRequest 

func NewDescribeBillingDataRequest() (request *DescribeBillingDataRequest)

func (*DescribeBillingDataRequest) FromJsonString 

func (r *DescribeBillingDataRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeBillingDataRequest) ToJsonString 

func (r *DescribeBillingDataRequest) ToJsonString() string

type DescribeBillingDataRequestParams 

type DescribeBillingDataRequestParams struct {
	// Start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// End time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// Site ID set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// Metric list. Valid values:
	// <li>acc_flux: content acceleration traffic, in bytes;</li>
	// <li>smt_flux: smart acceleration traffic, in bytes;</li>
	// <li>l4_flux: L4 acceleration traffic, in bytes;</li>
	// <li>sec_flux: exclusive protection traffic, in bytes;</li>
	// <li>zxctg_flux: network optimization traffic in the Chinese mainland, in bytes;</li>
	// <li>acc_bandwidth: content acceleration bandwidth, in bps;</li>
	// <li>smt_bandwidth: smart acceleration bandwidth, in bps;</li>
	// <li>l4_bandwidth: L4 acceleration bandwidth, in bps;</li>
	// <li>sec_bandwidth: exclusive protection bandwidth, in bps;</li>
	// <li>zxctg_bandwidth: network optimization bandwidth in the Chinese mainland, in bps;</li>
	// <li>sec_request_clean: number of HTTP/HTTPS requests;</li>
	// <li>smt_request_clean: number of smart acceleration requests;</li>
	// <li>quic_request: number of QUIC requests;</li>
	// <li>bot_request_clean: number of Bot requests;</li>
	// <li>cls_count: number of real-time log entries pushed;</li>
	// <li>ddos_bandwidth: elastic DDoS protection bandwidth, in bps.</li>
	MetricName *string `json:"MetricName,omitnil,omitempty" name:"MetricName"`

	// Time granularity of the query. Valid values:
	// <li>5min: 5 minutes;</li>
	// <li>hour: 1 hour;</li>
	// <li>day: 1 day.</li>
	Interval *string `json:"Interval,omitnil,omitempty" name:"Interval"`

	// Filter criteria. The detailed values of filter criteria are as follows:
	// <li>host: Filter by domain name, such as test.example.com.<br></li>
	// <li>proxy-id: Filter by L4 proxy instance ID, such as sid-2rugn89bkla9.<br></li>
	// <li>region-id: Filter by billing region. Options:<br>  CH: Chinese mainland<br>  AF: Africa<br>  AS1: Asia-Pacific Region 1<br>  AS2: Asia-Pacific Region 2<br>  AS3: Asia-Pacific Region 3<br>  EU: Europe<br>  MidEast: Middle East<br>  NA: North America<br>  SA: South America</li>
	Filters []*BillingDataFilter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

Predefined struct for user

type DescribeBillingDataResponse 

type DescribeBillingDataResponse struct {
	*tchttp.BaseResponse
	Response *DescribeBillingDataResponseParams `json:"Response"`
}

func NewDescribeBillingDataResponse 

func NewDescribeBillingDataResponse() (response *DescribeBillingDataResponse)

func (*DescribeBillingDataResponse) FromJsonString 

func (r *DescribeBillingDataResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeBillingDataResponse) ToJsonString 

func (r *DescribeBillingDataResponse) ToJsonString() string

type DescribeBillingDataResponseParams 

type DescribeBillingDataResponseParams struct {
	// Data point list.
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	Data []*BillingData `json:"Data,omitnil,omitempty" name:"Data"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeConfigGroupVersionDetailRequest 

type DescribeConfigGroupVersionDetailRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Version ID.
	VersionId *string `json:"VersionId,omitnil,omitempty" name:"VersionId"`
}

func NewDescribeConfigGroupVersionDetailRequest 

func NewDescribeConfigGroupVersionDetailRequest() (request *DescribeConfigGroupVersionDetailRequest)

func (*DescribeConfigGroupVersionDetailRequest) FromJsonString 

func (r *DescribeConfigGroupVersionDetailRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeConfigGroupVersionDetailRequest) ToJsonString 

func (r *DescribeConfigGroupVersionDetailRequest) ToJsonString() string

type DescribeConfigGroupVersionDetailRequestParams 

type DescribeConfigGroupVersionDetailRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Version ID.
	VersionId *string `json:"VersionId,omitnil,omitempty" name:"VersionId"`
}

Predefined struct for user

type DescribeConfigGroupVersionDetailResponse 

type DescribeConfigGroupVersionDetailResponse struct {
	*tchttp.BaseResponse
	Response *DescribeConfigGroupVersionDetailResponseParams `json:"Response"`
}

func NewDescribeConfigGroupVersionDetailResponse 

func NewDescribeConfigGroupVersionDetailResponse() (response *DescribeConfigGroupVersionDetailResponse)

func (*DescribeConfigGroupVersionDetailResponse) FromJsonString 

func (r *DescribeConfigGroupVersionDetailResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeConfigGroupVersionDetailResponse) ToJsonString 

func (r *DescribeConfigGroupVersionDetailResponse) ToJsonString() string

type DescribeConfigGroupVersionDetailResponseParams 

type DescribeConfigGroupVersionDetailResponseParams struct {
	// Version information.
	ConfigGroupVersionInfo *ConfigGroupVersionInfo `json:"ConfigGroupVersionInfo,omitnil,omitempty" name:"ConfigGroupVersionInfo"`

	// Version file content. It is returned in JSON format.
	Content *string `json:"Content,omitnil,omitempty" name:"Content"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeConfigGroupVersionsRequest 

type DescribeConfigGroupVersionsRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Configuraration group ID.
	GroupId *string `json:"GroupId,omitnil,omitempty" name:"GroupId"`

	// Filtering condition. The maximum value of Filters.Values is 20. If this parameter is not specified, all version information for the selected configuration group is returned. Detailed filtering conditions:
	// <li>version-id: Filter by version ID.</li>
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`

	// Paging query offset. The default value is 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Limited entries in paging queries. The default value is 20 and the maximum value is 100.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`
}

func NewDescribeConfigGroupVersionsRequest 

func NewDescribeConfigGroupVersionsRequest() (request *DescribeConfigGroupVersionsRequest)

func (*DescribeConfigGroupVersionsRequest) FromJsonString 

func (r *DescribeConfigGroupVersionsRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeConfigGroupVersionsRequest) ToJsonString 

func (r *DescribeConfigGroupVersionsRequest) ToJsonString() string

type DescribeConfigGroupVersionsRequestParams 

type DescribeConfigGroupVersionsRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Configuraration group ID.
	GroupId *string `json:"GroupId,omitnil,omitempty" name:"GroupId"`

	// Filtering condition. The maximum value of Filters.Values is 20. If this parameter is not specified, all version information for the selected configuration group is returned. Detailed filtering conditions:
	// <li>version-id: Filter by version ID.</li>
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`

	// Paging query offset. The default value is 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Limited entries in paging queries. The default value is 20 and the maximum value is 100.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`
}

Predefined struct for user

type DescribeConfigGroupVersionsResponse 

type DescribeConfigGroupVersionsResponse struct {
	*tchttp.BaseResponse
	Response *DescribeConfigGroupVersionsResponseParams `json:"Response"`
}

func NewDescribeConfigGroupVersionsResponse 

func NewDescribeConfigGroupVersionsResponse() (response *DescribeConfigGroupVersionsResponse)

func (*DescribeConfigGroupVersionsResponse) FromJsonString 

func (r *DescribeConfigGroupVersionsResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeConfigGroupVersionsResponse) ToJsonString 

func (r *DescribeConfigGroupVersionsResponse) ToJsonString() string

type DescribeConfigGroupVersionsResponseParams 

type DescribeConfigGroupVersionsResponseParams struct {
	// Total versions.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// Version information list.
	ConfigGroupVersionInfos []*ConfigGroupVersionInfo `json:"ConfigGroupVersionInfos,omitnil,omitempty" name:"ConfigGroupVersionInfos"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeContentQuotaRequest 

type DescribeContentQuotaRequest struct {
	*tchttp.BaseRequest

	// ID of the site.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`
}

func NewDescribeContentQuotaRequest 

func NewDescribeContentQuotaRequest() (request *DescribeContentQuotaRequest)

func (*DescribeContentQuotaRequest) FromJsonString 

func (r *DescribeContentQuotaRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeContentQuotaRequest) ToJsonString 

func (r *DescribeContentQuotaRequest) ToJsonString() string

type DescribeContentQuotaRequestParams 

type DescribeContentQuotaRequestParams struct {
	// ID of the site.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`
}

Predefined struct for user

type DescribeContentQuotaResponse 

type DescribeContentQuotaResponse struct {
	*tchttp.BaseResponse
	Response *DescribeContentQuotaResponseParams `json:"Response"`
}

func NewDescribeContentQuotaResponse 

func NewDescribeContentQuotaResponse() (response *DescribeContentQuotaResponse)

func (*DescribeContentQuotaResponse) FromJsonString 

func (r *DescribeContentQuotaResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeContentQuotaResponse) ToJsonString 

func (r *DescribeContentQuotaResponse) ToJsonString() string

type DescribeContentQuotaResponseParams 

type DescribeContentQuotaResponseParams struct {
	// Purging quotas.
	// Note: This field may return null, indicating that no valid values can be obtained.
	PurgeQuota []*Quota `json:"PurgeQuota,omitnil,omitempty" name:"PurgeQuota"`

	// Pre-warming quotas.
	// Note: This field may return null, indicating that no valid values can be obtained.
	PrefetchQuota []*Quota `json:"PrefetchQuota,omitnil,omitempty" name:"PrefetchQuota"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeCustomErrorPagesRequest 

type DescribeCustomErrorPagesRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Filter criteria. The maximum number of Filters.Values is 20. The detailed Name values of filter criteria are as follows:
	// <li>page-id: Filter by page ID;</li>
	// <li>name: Filter by page name;</li>
	// <li>description: Filter by page description;</li>
	// <li>content-type: Filter by page type.</li>
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`

	// The offset of paginated query. Default value: 0.
	Offset *uint64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// The limit of paginated query. Default value: 20. Maximum value: 1,000.
	Limit *uint64 `json:"Limit,omitnil,omitempty" name:"Limit"`
}

func NewDescribeCustomErrorPagesRequest 

func NewDescribeCustomErrorPagesRequest() (request *DescribeCustomErrorPagesRequest)

func (*DescribeCustomErrorPagesRequest) FromJsonString 

func (r *DescribeCustomErrorPagesRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeCustomErrorPagesRequest) ToJsonString 

func (r *DescribeCustomErrorPagesRequest) ToJsonString() string

type DescribeCustomErrorPagesRequestParams 

type DescribeCustomErrorPagesRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Filter criteria. The maximum number of Filters.Values is 20. The detailed Name values of filter criteria are as follows:
	// <li>page-id: Filter by page ID;</li>
	// <li>name: Filter by page name;</li>
	// <li>description: Filter by page description;</li>
	// <li>content-type: Filter by page type.</li>
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`

	// The offset of paginated query. Default value: 0.
	Offset *uint64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// The limit of paginated query. Default value: 20. Maximum value: 1,000.
	Limit *uint64 `json:"Limit,omitnil,omitempty" name:"Limit"`
}

Predefined struct for user

type DescribeCustomErrorPagesResponse 

type DescribeCustomErrorPagesResponse struct {
	*tchttp.BaseResponse
	Response *DescribeCustomErrorPagesResponseParams `json:"Response"`
}

func NewDescribeCustomErrorPagesResponse 

func NewDescribeCustomErrorPagesResponse() (response *DescribeCustomErrorPagesResponse)

func (*DescribeCustomErrorPagesResponse) FromJsonString 

func (r *DescribeCustomErrorPagesResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeCustomErrorPagesResponse) ToJsonString 

func (r *DescribeCustomErrorPagesResponse) ToJsonString() string

type DescribeCustomErrorPagesResponseParams 

type DescribeCustomErrorPagesResponseParams struct {
	// Total number of custom error pages.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// Custom error page data list.
	ErrorPages []*CustomErrorPage `json:"ErrorPages,omitnil,omitempty" name:"ErrorPages"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeDDoSAttackDataRequest 

type DescribeDDoSAttackDataRequest struct {
	*tchttp.BaseRequest

	// Start time of the query period.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// End time of the query period.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// Statistical metrics.
	// <li>`ddos_attackMaxBandwidth`: Peak attack bandwidth;</li>
	// <li>`ddos_attackMaxPackageRate`: Peak attack packet rate;</li>
	// <li>`ddos_attackBandwidth`: Time-series data of attack bandwidth;</li>
	// <li>`ddos_attackPackageRate`: Time-series data of attack packet rate.</li>
	MetricNames []*string `json:"MetricNames,omitnil,omitempty" name:"MetricNames"`

	// ZoneId set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// IDs of DDoS policies to be queried. All policies will be selected if this field is not specified.
	PolicyIds []*int64 `json:"PolicyIds,omitnil,omitempty" name:"PolicyIds"`

	// The query granularity. Values:
	// <li>`min`: 1 minute;</li>
	// <li>`5min`: 5 minutes;</li>
	// <li>`hour`: 1 hour;</li>
	// <li>`day`: 1 day</li>If this field is not specified, the granularity is determined based on the query period. <br>Period ≤ 1 hour: `min`; <br>1 hour < Period ≤ 2 days: `5min`; <br>2 days < Period ≤ 7 days: `hour`; <br>Period > 7 days: `day`.
	Interval *string `json:"Interval,omitnil,omitempty" name:"Interval"`

	// Geolocation scope. Values:
	// <li>`overseas`: Regions outside the Chinese mainland</li>
	// <li>`mainland`: Chinese mainland</li>
	// <li>`global`: Global </li>If this field is not specified, the default value `global` is used.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`
}

func NewDescribeDDoSAttackDataRequest 

func NewDescribeDDoSAttackDataRequest() (request *DescribeDDoSAttackDataRequest)

func (*DescribeDDoSAttackDataRequest) FromJsonString 

func (r *DescribeDDoSAttackDataRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeDDoSAttackDataRequest) ToJsonString 

func (r *DescribeDDoSAttackDataRequest) ToJsonString() string

type DescribeDDoSAttackDataRequestParams 

type DescribeDDoSAttackDataRequestParams struct {
	// Start time of the query period.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// End time of the query period.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// Statistical metrics.
	// <li>`ddos_attackMaxBandwidth`: Peak attack bandwidth;</li>
	// <li>`ddos_attackMaxPackageRate`: Peak attack packet rate;</li>
	// <li>`ddos_attackBandwidth`: Time-series data of attack bandwidth;</li>
	// <li>`ddos_attackPackageRate`: Time-series data of attack packet rate.</li>
	MetricNames []*string `json:"MetricNames,omitnil,omitempty" name:"MetricNames"`

	// ZoneId set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// IDs of DDoS policies to be queried. All policies will be selected if this field is not specified.
	PolicyIds []*int64 `json:"PolicyIds,omitnil,omitempty" name:"PolicyIds"`

	// The query granularity. Values:
	// <li>`min`: 1 minute;</li>
	// <li>`5min`: 5 minutes;</li>
	// <li>`hour`: 1 hour;</li>
	// <li>`day`: 1 day</li>If this field is not specified, the granularity is determined based on the query period. <br>Period ≤ 1 hour: `min`; <br>1 hour < Period ≤ 2 days: `5min`; <br>2 days < Period ≤ 7 days: `hour`; <br>Period > 7 days: `day`.
	Interval *string `json:"Interval,omitnil,omitempty" name:"Interval"`

	// Geolocation scope. Values:
	// <li>`overseas`: Regions outside the Chinese mainland</li>
	// <li>`mainland`: Chinese mainland</li>
	// <li>`global`: Global </li>If this field is not specified, the default value `global` is used.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`
}

Predefined struct for user

type DescribeDDoSAttackDataResponse 

type DescribeDDoSAttackDataResponse struct {
	*tchttp.BaseResponse
	Response *DescribeDDoSAttackDataResponseParams `json:"Response"`
}

func NewDescribeDDoSAttackDataResponse 

func NewDescribeDDoSAttackDataResponse() (response *DescribeDDoSAttackDataResponse)

func (*DescribeDDoSAttackDataResponse) FromJsonString 

func (r *DescribeDDoSAttackDataResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeDDoSAttackDataResponse) ToJsonString 

func (r *DescribeDDoSAttackDataResponse) ToJsonString() string

type DescribeDDoSAttackDataResponseParams 

type DescribeDDoSAttackDataResponseParams struct {
	// Total number of query results.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// List of DDoS attack data.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Data []*SecEntry `json:"Data,omitnil,omitempty" name:"Data"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeDDoSAttackEventRequest 

type DescribeDDoSAttackEventRequest struct {
	*tchttp.BaseRequest

	// Start time. Time range: 30 days.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// End time. Time range: 30 days.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// List of DDoS policy IDs. All policies are selected if this field is not specified.
	PolicyIds []*int64 `json:"PolicyIds,omitnil,omitempty" name:"PolicyIds"`

	// ZoneId set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// Limit on paginated queries. Default value: 20. Maximum value: 1000.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// The page offset. Default value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Parameter to show attack details. If it is configured as false, only the number of attacks is returned without details. If it is configured as true, attack details are returned.
	ShowDetail *bool `json:"ShowDetail,omitnil,omitempty" name:"ShowDetail"`

	// Geolocation scope. Values:
	// <li>`overseas`: Regions outside the Chinese mainland</li>
	// <li>`mainland`: Chinese mainland</li>
	// <li>`global`: Global</li>If this field is not specified, the default value `global` is used.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// The sorting field. Values:
	// <li>`MaxBandWidth`: Peak bandwidth</li>
	// <li>`AttackStartTime` Start time of the attack</li>If this field is not specified, the default value `AttackStartTime` is used.
	OrderBy *string `json:"OrderBy,omitnil,omitempty" name:"OrderBy"`

	// The sorting method. Values:
	// <Li>`asc`: Ascending</li>
	// <li>`desc`: Descending</li>If this field is not specified, the default value `desc` is used.
	OrderType *string `json:"OrderType,omitnil,omitempty" name:"OrderType"`
}

func NewDescribeDDoSAttackEventRequest 

func NewDescribeDDoSAttackEventRequest() (request *DescribeDDoSAttackEventRequest)

func (*DescribeDDoSAttackEventRequest) FromJsonString 

func (r *DescribeDDoSAttackEventRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeDDoSAttackEventRequest) ToJsonString 

func (r *DescribeDDoSAttackEventRequest) ToJsonString() string

type DescribeDDoSAttackEventRequestParams 

type DescribeDDoSAttackEventRequestParams struct {
	// Start time. Time range: 30 days.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// End time. Time range: 30 days.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// List of DDoS policy IDs. All policies are selected if this field is not specified.
	PolicyIds []*int64 `json:"PolicyIds,omitnil,omitempty" name:"PolicyIds"`

	// ZoneId set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// Limit on paginated queries. Default value: 20. Maximum value: 1000.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// The page offset. Default value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Parameter to show attack details. If it is configured as false, only the number of attacks is returned without details. If it is configured as true, attack details are returned.
	ShowDetail *bool `json:"ShowDetail,omitnil,omitempty" name:"ShowDetail"`

	// Geolocation scope. Values:
	// <li>`overseas`: Regions outside the Chinese mainland</li>
	// <li>`mainland`: Chinese mainland</li>
	// <li>`global`: Global</li>If this field is not specified, the default value `global` is used.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// The sorting field. Values:
	// <li>`MaxBandWidth`: Peak bandwidth</li>
	// <li>`AttackStartTime` Start time of the attack</li>If this field is not specified, the default value `AttackStartTime` is used.
	OrderBy *string `json:"OrderBy,omitnil,omitempty" name:"OrderBy"`

	// The sorting method. Values:
	// <Li>`asc`: Ascending</li>
	// <li>`desc`: Descending</li>If this field is not specified, the default value `desc` is used.
	OrderType *string `json:"OrderType,omitnil,omitempty" name:"OrderType"`
}

Predefined struct for user

type DescribeDDoSAttackEventResponse 

type DescribeDDoSAttackEventResponse struct {
	*tchttp.BaseResponse
	Response *DescribeDDoSAttackEventResponseParams `json:"Response"`
}

func NewDescribeDDoSAttackEventResponse 

func NewDescribeDDoSAttackEventResponse() (response *DescribeDDoSAttackEventResponse)

func (*DescribeDDoSAttackEventResponse) FromJsonString 

func (r *DescribeDDoSAttackEventResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeDDoSAttackEventResponse) ToJsonString 

func (r *DescribeDDoSAttackEventResponse) ToJsonString() string

type DescribeDDoSAttackEventResponseParams 

type DescribeDDoSAttackEventResponseParams struct {
	// List of DDoS attack data.
	// Note: This field may return `null`, indicating that no valid value was found.
	Data []*DDoSAttackEvent `json:"Data,omitnil,omitempty" name:"Data"`

	// Total number of query results.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeDDoSAttackTopDataRequest 

type DescribeDDoSAttackTopDataRequest struct {
	*tchttp.BaseRequest

	// The start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// The end time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// The statistical metric. Values:
	// <li>`ddos_attackFlux_protocol`: Rank protocols by the attack traffic.</li>
	// <li>`ddos_attackPackageNum_protocol`: Rank protocols by the number of attack packets.</li>
	// <li>`ddos_attackNum_attackType`: Rank attack types by the number of attacks.</li>
	// <li>`ddos_attackNum_sregion`: Rank attacker regions by the number of attacks.</li>
	// <li>`ddos_attackFlux_sip`: Rank attacker IPs by the number of attacks.</li>
	// <li>`ddos_attackFlux_sregion`: Rank attacker regions by the number of attacks.</li>
	MetricName *string `json:"MetricName,omitnil,omitempty" name:"MetricName"`

	// Site ID set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// The list of DDoS policy IDs to be specified. All policies will be selected if this field is not specified.
	PolicyIds []*int64 `json:"PolicyIds,omitnil,omitempty" name:"PolicyIds"`

	// The attack type. Values:
	// <li>`flood`: Flood;</li>
	// <li>`icmpFlood`: ICMP flood;</li>
	// <li>`all`: All attack types.</li>This field will be set to the default value `all` if not specified.
	AttackType *string `json:"AttackType,omitnil,omitempty" name:"AttackType"`

	// The protocol type. Values:
	// <li>`tcp`: TCP protocol;</li>
	// <li>`udp`: UDP protocol;</li>
	// <li>`all`: All protocol types.</li>This field will be set to the default value `all` if not specified.
	ProtocolType *string `json:"ProtocolType,omitnil,omitempty" name:"ProtocolType"`

	// The port number.
	Port *int64 `json:"Port,omitnil,omitempty" name:"Port"`

	// Queries the top n rows of data. Top 10 rows of data will be queried if this field is not specified.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Data storage region. Values:
	// <li>`overseas`: Global (outside the Chinese mainland);</li>
	// <li>`mainland`: Chinese mainland.</li>If this field is not specified, the data storage region will be determined based on the user’s location.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`
}

func NewDescribeDDoSAttackTopDataRequest 

func NewDescribeDDoSAttackTopDataRequest() (request *DescribeDDoSAttackTopDataRequest)

func (*DescribeDDoSAttackTopDataRequest) FromJsonString 

func (r *DescribeDDoSAttackTopDataRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeDDoSAttackTopDataRequest) ToJsonString 

func (r *DescribeDDoSAttackTopDataRequest) ToJsonString() string

type DescribeDDoSAttackTopDataRequestParams 

type DescribeDDoSAttackTopDataRequestParams struct {
	// The start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// The end time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// The statistical metric. Values:
	// <li>`ddos_attackFlux_protocol`: Rank protocols by the attack traffic.</li>
	// <li>`ddos_attackPackageNum_protocol`: Rank protocols by the number of attack packets.</li>
	// <li>`ddos_attackNum_attackType`: Rank attack types by the number of attacks.</li>
	// <li>`ddos_attackNum_sregion`: Rank attacker regions by the number of attacks.</li>
	// <li>`ddos_attackFlux_sip`: Rank attacker IPs by the number of attacks.</li>
	// <li>`ddos_attackFlux_sregion`: Rank attacker regions by the number of attacks.</li>
	MetricName *string `json:"MetricName,omitnil,omitempty" name:"MetricName"`

	// Site ID set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// The list of DDoS policy IDs to be specified. All policies will be selected if this field is not specified.
	PolicyIds []*int64 `json:"PolicyIds,omitnil,omitempty" name:"PolicyIds"`

	// The attack type. Values:
	// <li>`flood`: Flood;</li>
	// <li>`icmpFlood`: ICMP flood;</li>
	// <li>`all`: All attack types.</li>This field will be set to the default value `all` if not specified.
	AttackType *string `json:"AttackType,omitnil,omitempty" name:"AttackType"`

	// The protocol type. Values:
	// <li>`tcp`: TCP protocol;</li>
	// <li>`udp`: UDP protocol;</li>
	// <li>`all`: All protocol types.</li>This field will be set to the default value `all` if not specified.
	ProtocolType *string `json:"ProtocolType,omitnil,omitempty" name:"ProtocolType"`

	// The port number.
	Port *int64 `json:"Port,omitnil,omitempty" name:"Port"`

	// Queries the top n rows of data. Top 10 rows of data will be queried if this field is not specified.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Data storage region. Values:
	// <li>`overseas`: Global (outside the Chinese mainland);</li>
	// <li>`mainland`: Chinese mainland.</li>If this field is not specified, the data storage region will be determined based on the user’s location.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`
}

Predefined struct for user

type DescribeDDoSAttackTopDataResponse 

type DescribeDDoSAttackTopDataResponse struct {
	*tchttp.BaseResponse
	Response *DescribeDDoSAttackTopDataResponseParams `json:"Response"`
}

func NewDescribeDDoSAttackTopDataResponse 

func NewDescribeDDoSAttackTopDataResponse() (response *DescribeDDoSAttackTopDataResponse)

func (*DescribeDDoSAttackTopDataResponse) FromJsonString 

func (r *DescribeDDoSAttackTopDataResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeDDoSAttackTopDataResponse) ToJsonString 

func (r *DescribeDDoSAttackTopDataResponse) ToJsonString() string

type DescribeDDoSAttackTopDataResponseParams 

type DescribeDDoSAttackTopDataResponseParams struct {
	// The list of top-ranked DDoS attack data.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Data []*TopEntry `json:"Data,omitnil,omitempty" name:"Data"`

	// Total number of query results.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeDefaultCertificatesRequest 

type DescribeDefaultCertificatesRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Filter criteria. Each filter criteria can have up to 5 entries.
	// <li>`zone-id`: <br>Filter by <strong>site ID</strong>, such as zone-xxx<br>   Type: String<br>   Required: No</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`

	// Offset for paginated queries. Default value: `0`
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Limit on paginated queries. Default value: `20`. Maximum value: `100`.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`
}

func NewDescribeDefaultCertificatesRequest 

func NewDescribeDefaultCertificatesRequest() (request *DescribeDefaultCertificatesRequest)

func (*DescribeDefaultCertificatesRequest) FromJsonString 

func (r *DescribeDefaultCertificatesRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeDefaultCertificatesRequest) ToJsonString 

func (r *DescribeDefaultCertificatesRequest) ToJsonString() string

type DescribeDefaultCertificatesRequestParams 

type DescribeDefaultCertificatesRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Filter criteria. Each filter criteria can have up to 5 entries.
	// <li>`zone-id`: <br>Filter by <strong>site ID</strong>, such as zone-xxx<br>   Type: String<br>   Required: No</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`

	// Offset for paginated queries. Default value: `0`
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Limit on paginated queries. Default value: `20`. Maximum value: `100`.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`
}

Predefined struct for user

type DescribeDefaultCertificatesResponse 

type DescribeDefaultCertificatesResponse struct {
	*tchttp.BaseResponse
	Response *DescribeDefaultCertificatesResponseParams `json:"Response"`
}

func NewDescribeDefaultCertificatesResponse 

func NewDescribeDefaultCertificatesResponse() (response *DescribeDefaultCertificatesResponse)

func (*DescribeDefaultCertificatesResponse) FromJsonString 

func (r *DescribeDefaultCertificatesResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeDefaultCertificatesResponse) ToJsonString 

func (r *DescribeDefaultCertificatesResponse) ToJsonString() string

type DescribeDefaultCertificatesResponseParams 

type DescribeDefaultCertificatesResponseParams struct {
	// Total number of certificates
	TotalCount *int64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// List of default certificates
	DefaultServerCertInfo []*DefaultServerCertInfo `json:"DefaultServerCertInfo,omitnil,omitempty" name:"DefaultServerCertInfo"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeDeployHistoryRequest 

type DescribeDeployHistoryRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Environment ID.
	EnvId *string `json:"EnvId,omitnil,omitempty" name:"EnvId"`

	// Filtering condition. The maximum value of Filters.Values is 20. Detailed filtering conditions:
	// <li>record-id: Filter by release record ID. </li>
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

func NewDescribeDeployHistoryRequest 

func NewDescribeDeployHistoryRequest() (request *DescribeDeployHistoryRequest)

func (*DescribeDeployHistoryRequest) FromJsonString 

func (r *DescribeDeployHistoryRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeDeployHistoryRequest) ToJsonString 

func (r *DescribeDeployHistoryRequest) ToJsonString() string

type DescribeDeployHistoryRequestParams 

type DescribeDeployHistoryRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Environment ID.
	EnvId *string `json:"EnvId,omitnil,omitempty" name:"EnvId"`

	// Filtering condition. The maximum value of Filters.Values is 20. Detailed filtering conditions:
	// <li>record-id: Filter by release record ID. </li>
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

Predefined struct for user

type DescribeDeployHistoryResponse 

type DescribeDeployHistoryResponse struct {
	*tchttp.BaseResponse
	Response *DescribeDeployHistoryResponseParams `json:"Response"`
}

func NewDescribeDeployHistoryResponse 

func NewDescribeDeployHistoryResponse() (response *DescribeDeployHistoryResponse)

func (*DescribeDeployHistoryResponse) FromJsonString 

func (r *DescribeDeployHistoryResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeDeployHistoryResponse) ToJsonString 

func (r *DescribeDeployHistoryResponse) ToJsonString() string

type DescribeDeployHistoryResponseParams 

type DescribeDeployHistoryResponseParams struct {
	// Total release records.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// Release record details.
	Records []*DeployRecord `json:"Records,omitnil,omitempty" name:"Records"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeEnvironmentsRequest 

type DescribeEnvironmentsRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`
}

func NewDescribeEnvironmentsRequest 

func NewDescribeEnvironmentsRequest() (request *DescribeEnvironmentsRequest)

func (*DescribeEnvironmentsRequest) FromJsonString 

func (r *DescribeEnvironmentsRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeEnvironmentsRequest) ToJsonString 

func (r *DescribeEnvironmentsRequest) ToJsonString() string

type DescribeEnvironmentsRequestParams 

type DescribeEnvironmentsRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`
}

Predefined struct for user

type DescribeEnvironmentsResponse 

type DescribeEnvironmentsResponse struct {
	*tchttp.BaseResponse
	Response *DescribeEnvironmentsResponseParams `json:"Response"`
}

func NewDescribeEnvironmentsResponse 

func NewDescribeEnvironmentsResponse() (response *DescribeEnvironmentsResponse)

func (*DescribeEnvironmentsResponse) FromJsonString 

func (r *DescribeEnvironmentsResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeEnvironmentsResponse) ToJsonString 

func (r *DescribeEnvironmentsResponse) ToJsonString() string

type DescribeEnvironmentsResponseParams 

type DescribeEnvironmentsResponseParams struct {
	// Total environments.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// Environment list.
	EnvInfos []*EnvInfo `json:"EnvInfos,omitnil,omitempty" name:"EnvInfos"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeFunctionRulesRequest 

type DescribeFunctionRulesRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Filter criteria list. There is an AND relationship between different criteria. The maximum number of Filters.Values is 20. The detailed filter criteria are as follows:
	// <li>rule-id: Exact match by [rule ID].</li>
	// <li>function-id: Exact match by [function ID].</li>
	// <li>remark: Fuzzy match by [rule description].</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

func NewDescribeFunctionRulesRequest 

func NewDescribeFunctionRulesRequest() (request *DescribeFunctionRulesRequest)

func (*DescribeFunctionRulesRequest) FromJsonString 

func (r *DescribeFunctionRulesRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeFunctionRulesRequest) ToJsonString 

func (r *DescribeFunctionRulesRequest) ToJsonString() string

type DescribeFunctionRulesRequestParams 

type DescribeFunctionRulesRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Filter criteria list. There is an AND relationship between different criteria. The maximum number of Filters.Values is 20. The detailed filter criteria are as follows:
	// <li>rule-id: Exact match by [rule ID].</li>
	// <li>function-id: Exact match by [function ID].</li>
	// <li>remark: Fuzzy match by [rule description].</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

Predefined struct for user

type DescribeFunctionRulesResponse 

type DescribeFunctionRulesResponse struct {
	*tchttp.BaseResponse
	Response *DescribeFunctionRulesResponseParams `json:"Response"`
}

func NewDescribeFunctionRulesResponse 

func NewDescribeFunctionRulesResponse() (response *DescribeFunctionRulesResponse)

func (*DescribeFunctionRulesResponse) FromJsonString 

func (r *DescribeFunctionRulesResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeFunctionRulesResponse) ToJsonString 

func (r *DescribeFunctionRulesResponse) ToJsonString() string

type DescribeFunctionRulesResponseParams 

type DescribeFunctionRulesResponseParams struct {
	// Rule details list.
	FunctionRules []*FunctionRule `json:"FunctionRules,omitnil,omitempty" name:"FunctionRules"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeFunctionRuntimeEnvironmentRequest 

type DescribeFunctionRuntimeEnvironmentRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Function ID.
	FunctionId *string `json:"FunctionId,omitnil,omitempty" name:"FunctionId"`
}

func NewDescribeFunctionRuntimeEnvironmentRequest 

func NewDescribeFunctionRuntimeEnvironmentRequest() (request *DescribeFunctionRuntimeEnvironmentRequest)

func (*DescribeFunctionRuntimeEnvironmentRequest) FromJsonString 

func (r *DescribeFunctionRuntimeEnvironmentRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeFunctionRuntimeEnvironmentRequest) ToJsonString 

func (r *DescribeFunctionRuntimeEnvironmentRequest) ToJsonString() string

type DescribeFunctionRuntimeEnvironmentRequestParams 

type DescribeFunctionRuntimeEnvironmentRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Function ID.
	FunctionId *string `json:"FunctionId,omitnil,omitempty" name:"FunctionId"`
}

Predefined struct for user

type DescribeFunctionRuntimeEnvironmentResponse 

type DescribeFunctionRuntimeEnvironmentResponse struct {
	*tchttp.BaseResponse
	Response *DescribeFunctionRuntimeEnvironmentResponseParams `json:"Response"`
}

func NewDescribeFunctionRuntimeEnvironmentResponse 

func NewDescribeFunctionRuntimeEnvironmentResponse() (response *DescribeFunctionRuntimeEnvironmentResponse)

func (*DescribeFunctionRuntimeEnvironmentResponse) FromJsonString 

func (r *DescribeFunctionRuntimeEnvironmentResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeFunctionRuntimeEnvironmentResponse) ToJsonString 

func (r *DescribeFunctionRuntimeEnvironmentResponse) ToJsonString() string

type DescribeFunctionRuntimeEnvironmentResponseParams 

type DescribeFunctionRuntimeEnvironmentResponseParams struct {
	// Environment variable list.
	EnvironmentVariables []*FunctionEnvironmentVariable `json:"EnvironmentVariables,omitnil,omitempty" name:"EnvironmentVariables"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeFunctionsRequest 

type DescribeFunctionsRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Filter by function ID list.
	FunctionIds []*string `json:"FunctionIds,omitnil,omitempty" name:"FunctionIds"`

	// Filter criteria list. There is an AND relationship between different criteria. The maximum number of Filters.Values is 20. The detailed filter criteria are as follows:
	// <li>name: Fuzzy match by [function name].</li>
	// <li>remark: Fuzzy match by [function description].</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`

	// The offset of paginated query. Default value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Number limit of paginated query. Default value: 20. Maximum value: 200.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`
}

func NewDescribeFunctionsRequest 

func NewDescribeFunctionsRequest() (request *DescribeFunctionsRequest)

func (*DescribeFunctionsRequest) FromJsonString 

func (r *DescribeFunctionsRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeFunctionsRequest) ToJsonString 

func (r *DescribeFunctionsRequest) ToJsonString() string

type DescribeFunctionsRequestParams 

type DescribeFunctionsRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Filter by function ID list.
	FunctionIds []*string `json:"FunctionIds,omitnil,omitempty" name:"FunctionIds"`

	// Filter criteria list. There is an AND relationship between different criteria. The maximum number of Filters.Values is 20. The detailed filter criteria are as follows:
	// <li>name: Fuzzy match by [function name].</li>
	// <li>remark: Fuzzy match by [function description].</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`

	// The offset of paginated query. Default value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Number limit of paginated query. Default value: 20. Maximum value: 200.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`
}

Predefined struct for user

type DescribeFunctionsResponse 

type DescribeFunctionsResponse struct {
	*tchttp.BaseResponse
	Response *DescribeFunctionsResponseParams `json:"Response"`
}

func NewDescribeFunctionsResponse 

func NewDescribeFunctionsResponse() (response *DescribeFunctionsResponse)

func (*DescribeFunctionsResponse) FromJsonString 

func (r *DescribeFunctionsResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeFunctionsResponse) ToJsonString 

func (r *DescribeFunctionsResponse) ToJsonString() string

type DescribeFunctionsResponseParams 

type DescribeFunctionsResponseParams struct {
	// Total number of functions that meet the query condition.
	TotalCount *int64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// Information of all functions that meet the query condition.
	Functions []*Function `json:"Functions,omitnil,omitempty" name:"Functions"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeHostsSettingRequest 

type DescribeHostsSettingRequest struct {
	*tchttp.BaseRequest

	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Offset for paginated queries. Default value: 0. Minimum value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Limit on paginated queries. Default value: 100. Maximum value: 1000.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter conditions. The maximum value for Filters.Values is 20. The detailed conditions are as follows:<li>host: Filter by domain name.</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

func NewDescribeHostsSettingRequest 

func NewDescribeHostsSettingRequest() (request *DescribeHostsSettingRequest)

func (*DescribeHostsSettingRequest) FromJsonString 

func (r *DescribeHostsSettingRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeHostsSettingRequest) ToJsonString 

func (r *DescribeHostsSettingRequest) ToJsonString() string

type DescribeHostsSettingRequestParams 

type DescribeHostsSettingRequestParams struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Offset for paginated queries. Default value: 0. Minimum value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Limit on paginated queries. Default value: 100. Maximum value: 1000.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter conditions. The maximum value for Filters.Values is 20. The detailed conditions are as follows:<li>host: Filter by domain name.</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

Predefined struct for user

type DescribeHostsSettingResponse 

type DescribeHostsSettingResponse struct {
	*tchttp.BaseResponse
	Response *DescribeHostsSettingResponseParams `json:"Response"`
}

func NewDescribeHostsSettingResponse 

func NewDescribeHostsSettingResponse() (response *DescribeHostsSettingResponse)

func (*DescribeHostsSettingResponse) FromJsonString 

func (r *DescribeHostsSettingResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeHostsSettingResponse) ToJsonString 

func (r *DescribeHostsSettingResponse) ToJsonString() string

type DescribeHostsSettingResponseParams 

type DescribeHostsSettingResponseParams struct {
	// List of domain names.
	DetailHosts []*DetailHost `json:"DetailHosts,omitnil,omitempty" name:"DetailHosts"`

	// Number of domain names
	TotalNumber *int64 `json:"TotalNumber,omitnil,omitempty" name:"TotalNumber"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeIPRegionRequest 

type DescribeIPRegionRequest struct {
	*tchttp.BaseRequest

	// List of IPs to be queried, supporting IPV4 and IPV6. Up to 100 can be queried.
	IPs []*string `json:"IPs,omitnil,omitempty" name:"IPs"`
}

func NewDescribeIPRegionRequest 

func NewDescribeIPRegionRequest() (request *DescribeIPRegionRequest)

func (*DescribeIPRegionRequest) FromJsonString 

func (r *DescribeIPRegionRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeIPRegionRequest) ToJsonString 

func (r *DescribeIPRegionRequest) ToJsonString() string

type DescribeIPRegionRequestParams 

type DescribeIPRegionRequestParams struct {
	// List of IPs to be queried, supporting IPV4 and IPV6. Up to 100 can be queried.
	IPs []*string `json:"IPs,omitnil,omitempty" name:"IPs"`
}

Predefined struct for user

type DescribeIPRegionResponse 

type DescribeIPRegionResponse struct {
	*tchttp.BaseResponse
	Response *DescribeIPRegionResponseParams `json:"Response"`
}

func NewDescribeIPRegionResponse 

func NewDescribeIPRegionResponse() (response *DescribeIPRegionResponse)

func (*DescribeIPRegionResponse) FromJsonString 

func (r *DescribeIPRegionResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeIPRegionResponse) ToJsonString 

func (r *DescribeIPRegionResponse) ToJsonString() string

type DescribeIPRegionResponseParams 

type DescribeIPRegionResponseParams struct {
	// List of IP attribution information.
	IPRegionInfo []*IPRegionInfo `json:"IPRegionInfo,omitnil,omitempty" name:"IPRegionInfo"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeIdentificationsRequest 

type DescribeIdentificationsRequest struct {
	*tchttp.BaseRequest

	// Filter conditions. The maximum value for Filters.Values is 20. The detailed conditions are as follows:<li>zone-name: Filter by site name.</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`

	// The page offset. Default value: 0
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// The paginated query limit. Default value: 20. Maximum value: 1000.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`
}

func NewDescribeIdentificationsRequest 

func NewDescribeIdentificationsRequest() (request *DescribeIdentificationsRequest)

func (*DescribeIdentificationsRequest) FromJsonString 

func (r *DescribeIdentificationsRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeIdentificationsRequest) ToJsonString 

func (r *DescribeIdentificationsRequest) ToJsonString() string

type DescribeIdentificationsRequestParams 

type DescribeIdentificationsRequestParams struct {
	// Filter conditions. The maximum value for Filters.Values is 20. The detailed conditions are as follows:<li>zone-name: Filter by site name.</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`

	// The page offset. Default value: 0
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// The paginated query limit. Default value: 20. Maximum value: 1000.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`
}

Predefined struct for user

type DescribeIdentificationsResponse 

type DescribeIdentificationsResponse struct {
	*tchttp.BaseResponse
	Response *DescribeIdentificationsResponseParams `json:"Response"`
}

func NewDescribeIdentificationsResponse 

func NewDescribeIdentificationsResponse() (response *DescribeIdentificationsResponse)

func (*DescribeIdentificationsResponse) FromJsonString 

func (r *DescribeIdentificationsResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeIdentificationsResponse) ToJsonString 

func (r *DescribeIdentificationsResponse) ToJsonString() string

type DescribeIdentificationsResponseParams 

type DescribeIdentificationsResponseParams struct {
	// Number of eligible sites.
	TotalCount *int64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// The site verification information.
	Identifications []*Identification `json:"Identifications,omitnil,omitempty" name:"Identifications"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeL4ProxyRequest 

type DescribeL4ProxyRequest struct {
	*tchttp.BaseRequest

	// ID of the zone where the Layer 4 proxy instance belongs.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Paginated query offset. Defaults to 0 when not specified.
	Offset *uint64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Paginated query limit. Default value: 20. Maximum value: 1000.
	Limit *uint64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter criteria. The upper limit for Filters.Values is 20. If left empty, all Layer 4 proxy instance information under the current zone ID is returned. The detailed filter criteria are as follows: <li>proxy-id: Filters by Layer 4 proxy instance ID;</li>
	// <li>ddos-protection-type: Filters by security protection type;</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

func NewDescribeL4ProxyRequest 

func NewDescribeL4ProxyRequest() (request *DescribeL4ProxyRequest)

func (*DescribeL4ProxyRequest) FromJsonString 

func (r *DescribeL4ProxyRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeL4ProxyRequest) ToJsonString 

func (r *DescribeL4ProxyRequest) ToJsonString() string

type DescribeL4ProxyRequestParams 

type DescribeL4ProxyRequestParams struct {
	// ID of the zone where the Layer 4 proxy instance belongs.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Paginated query offset. Defaults to 0 when not specified.
	Offset *uint64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Paginated query limit. Default value: 20. Maximum value: 1000.
	Limit *uint64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter criteria. The upper limit for Filters.Values is 20. If left empty, all Layer 4 proxy instance information under the current zone ID is returned. The detailed filter criteria are as follows: <li>proxy-id: Filters by Layer 4 proxy instance ID;</li>
	// <li>ddos-protection-type: Filters by security protection type;</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

Predefined struct for user

type DescribeL4ProxyResponse 

type DescribeL4ProxyResponse struct {
	*tchttp.BaseResponse
	Response *DescribeL4ProxyResponseParams `json:"Response"`
}

func NewDescribeL4ProxyResponse 

func NewDescribeL4ProxyResponse() (response *DescribeL4ProxyResponse)

func (*DescribeL4ProxyResponse) FromJsonString 

func (r *DescribeL4ProxyResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeL4ProxyResponse) ToJsonString 

func (r *DescribeL4ProxyResponse) ToJsonString() string

type DescribeL4ProxyResponseParams 

type DescribeL4ProxyResponseParams struct {
	// The number of Layer 4 proxy instances.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// List of Layer 4 proxy instances.
	L4Proxies []*L4Proxy `json:"L4Proxies,omitnil,omitempty" name:"L4Proxies"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeL4ProxyRulesRequest 

type DescribeL4ProxyRulesRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Layer 4 proxy instance ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// Paginated query offset. Defaults to 0 when not specified.
	Offset *uint64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Paginated query limit. Default value: 20. Maximum value: 1000.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter criteria. The upper limit for Filters.Values is 20. All rule information under the current Layer 4 instance will be returned if left empty. The detailed filter criteria are as follows: <li>rule-tag: Filters rules under the Layer 4 proxy instance according to rule tag.</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

func NewDescribeL4ProxyRulesRequest 

func NewDescribeL4ProxyRulesRequest() (request *DescribeL4ProxyRulesRequest)

func (*DescribeL4ProxyRulesRequest) FromJsonString 

func (r *DescribeL4ProxyRulesRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeL4ProxyRulesRequest) ToJsonString 

func (r *DescribeL4ProxyRulesRequest) ToJsonString() string

type DescribeL4ProxyRulesRequestParams 

type DescribeL4ProxyRulesRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Layer 4 proxy instance ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// Paginated query offset. Defaults to 0 when not specified.
	Offset *uint64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Paginated query limit. Default value: 20. Maximum value: 1000.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter criteria. The upper limit for Filters.Values is 20. All rule information under the current Layer 4 instance will be returned if left empty. The detailed filter criteria are as follows: <li>rule-tag: Filters rules under the Layer 4 proxy instance according to rule tag.</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

Predefined struct for user

type DescribeL4ProxyRulesResponse 

type DescribeL4ProxyRulesResponse struct {
	*tchttp.BaseResponse
	Response *DescribeL4ProxyRulesResponseParams `json:"Response"`
}

func NewDescribeL4ProxyRulesResponse 

func NewDescribeL4ProxyRulesResponse() (response *DescribeL4ProxyRulesResponse)

func (*DescribeL4ProxyRulesResponse) FromJsonString 

func (r *DescribeL4ProxyRulesResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeL4ProxyRulesResponse) ToJsonString 

func (r *DescribeL4ProxyRulesResponse) ToJsonString() string

type DescribeL4ProxyRulesResponseParams 

type DescribeL4ProxyRulesResponseParams struct {
	// The total count of forwarding rules.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// List of forwarding rules.
	L4ProxyRules []*L4ProxyRule `json:"L4ProxyRules,omitnil,omitempty" name:"L4ProxyRules"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeLoadBalancerListRequest 

type DescribeLoadBalancerListRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Offset of paginated query. Default value: 0.
	Offset *uint64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Paginated query limit. Default value: 20, maximum value: 100.
	Limit *uint64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter criteria. The maximum value of Filters.Values is 20. If this parameter is left empty, all LoadBalancer information under the current zone ID will be returned. The detailed filter criteria are as follows:
	// <li>InstanceName: Filter by LoadBalancer name.</li>
	// <li>InstanceId: Filter by LoadBalancer ID.</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

func NewDescribeLoadBalancerListRequest 

func NewDescribeLoadBalancerListRequest() (request *DescribeLoadBalancerListRequest)

func (*DescribeLoadBalancerListRequest) FromJsonString 

func (r *DescribeLoadBalancerListRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeLoadBalancerListRequest) ToJsonString 

func (r *DescribeLoadBalancerListRequest) ToJsonString() string

type DescribeLoadBalancerListRequestParams 

type DescribeLoadBalancerListRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Offset of paginated query. Default value: 0.
	Offset *uint64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Paginated query limit. Default value: 20, maximum value: 100.
	Limit *uint64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter criteria. The maximum value of Filters.Values is 20. If this parameter is left empty, all LoadBalancer information under the current zone ID will be returned. The detailed filter criteria are as follows:
	// <li>InstanceName: Filter by LoadBalancer name.</li>
	// <li>InstanceId: Filter by LoadBalancer ID.</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

Predefined struct for user

type DescribeLoadBalancerListResponse 

type DescribeLoadBalancerListResponse struct {
	*tchttp.BaseResponse
	Response *DescribeLoadBalancerListResponseParams `json:"Response"`
}

func NewDescribeLoadBalancerListResponse 

func NewDescribeLoadBalancerListResponse() (response *DescribeLoadBalancerListResponse)

func (*DescribeLoadBalancerListResponse) FromJsonString 

func (r *DescribeLoadBalancerListResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeLoadBalancerListResponse) ToJsonString 

func (r *DescribeLoadBalancerListResponse) ToJsonString() string

type DescribeLoadBalancerListResponseParams 

type DescribeLoadBalancerListResponseParams struct {
	// Total number of LoadBalancers.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// LoadBalancer list.
	LoadBalancerList []*LoadBalancer `json:"LoadBalancerList,omitnil,omitempty" name:"LoadBalancerList"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeOriginGroupHealthStatusRequest 

type DescribeOriginGroupHealthStatusRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// CLB instance ID.
	LBInstanceId *string `json:"LBInstanceId,omitnil,omitempty" name:"LBInstanceId"`

	// Origin server group ID. If left empty, the health status of all origin server groups under a LoadBalancer is obtained by default.
	OriginGroupIds []*string `json:"OriginGroupIds,omitnil,omitempty" name:"OriginGroupIds"`
}

func NewDescribeOriginGroupHealthStatusRequest 

func NewDescribeOriginGroupHealthStatusRequest() (request *DescribeOriginGroupHealthStatusRequest)

func (*DescribeOriginGroupHealthStatusRequest) FromJsonString 

func (r *DescribeOriginGroupHealthStatusRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeOriginGroupHealthStatusRequest) ToJsonString 

func (r *DescribeOriginGroupHealthStatusRequest) ToJsonString() string

type DescribeOriginGroupHealthStatusRequestParams 

type DescribeOriginGroupHealthStatusRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// CLB instance ID.
	LBInstanceId *string `json:"LBInstanceId,omitnil,omitempty" name:"LBInstanceId"`

	// Origin server group ID. If left empty, the health status of all origin server groups under a LoadBalancer is obtained by default.
	OriginGroupIds []*string `json:"OriginGroupIds,omitnil,omitempty" name:"OriginGroupIds"`
}

Predefined struct for user

type DescribeOriginGroupHealthStatusResponse 

type DescribeOriginGroupHealthStatusResponse struct {
	*tchttp.BaseResponse
	Response *DescribeOriginGroupHealthStatusResponseParams `json:"Response"`
}

func NewDescribeOriginGroupHealthStatusResponse 

func NewDescribeOriginGroupHealthStatusResponse() (response *DescribeOriginGroupHealthStatusResponse)

func (*DescribeOriginGroupHealthStatusResponse) FromJsonString 

func (r *DescribeOriginGroupHealthStatusResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeOriginGroupHealthStatusResponse) ToJsonString 

func (r *DescribeOriginGroupHealthStatusResponse) ToJsonString() string

type DescribeOriginGroupHealthStatusResponseParams 

type DescribeOriginGroupHealthStatusResponseParams struct {
	// Health status of origin servers in an origin server group.
	OriginGroupHealthStatusList []*OriginGroupHealthStatusDetail `json:"OriginGroupHealthStatusList,omitnil,omitempty" name:"OriginGroupHealthStatusList"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeOriginGroupRequest 

type DescribeOriginGroupRequest struct {
	*tchttp.BaseRequest

	// (Required) Site ID
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The paginated query offset. Default value: 0
	Offset *uint64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Limit on paginated queries. Value range: 1-1000. Default value: 20.
	Limit *uint64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filters. Each filter can have up to 20 entries. See below for details:
	// <li>`origin-group-id`<br>Filter by the <strong>origin group ID</strong>. Format: `origin-2ccgtb24-7dc5-46s2-9r3e-95825d53dwe3a`<br>Fuzzy query is not supported</li><li>`origin-group-name`<br>Filter by the <strong>origin group name</strong><br>Fuzzy query is supported. When fuzzy query is used, only one origin groupsource site group name is supported</li>
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

func NewDescribeOriginGroupRequest 

func NewDescribeOriginGroupRequest() (request *DescribeOriginGroupRequest)

func (*DescribeOriginGroupRequest) FromJsonString 

func (r *DescribeOriginGroupRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeOriginGroupRequest) ToJsonString 

func (r *DescribeOriginGroupRequest) ToJsonString() string

type DescribeOriginGroupRequestParams 

type DescribeOriginGroupRequestParams struct {
	// (Required) Site ID
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The paginated query offset. Default value: 0
	Offset *uint64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Limit on paginated queries. Value range: 1-1000. Default value: 20.
	Limit *uint64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filters. Each filter can have up to 20 entries. See below for details:
	// <li>`origin-group-id`<br>Filter by the <strong>origin group ID</strong>. Format: `origin-2ccgtb24-7dc5-46s2-9r3e-95825d53dwe3a`<br>Fuzzy query is not supported</li><li>`origin-group-name`<br>Filter by the <strong>origin group name</strong><br>Fuzzy query is supported. When fuzzy query is used, only one origin groupsource site group name is supported</li>
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

Predefined struct for user

type DescribeOriginGroupResponse 

type DescribeOriginGroupResponse struct {
	*tchttp.BaseResponse
	Response *DescribeOriginGroupResponseParams `json:"Response"`
}

func NewDescribeOriginGroupResponse 

func NewDescribeOriginGroupResponse() (response *DescribeOriginGroupResponse)

func (*DescribeOriginGroupResponse) FromJsonString 

func (r *DescribeOriginGroupResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeOriginGroupResponse) ToJsonString 

func (r *DescribeOriginGroupResponse) ToJsonString() string

type DescribeOriginGroupResponseParams 

type DescribeOriginGroupResponseParams struct {
	// Total number of records.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// Origin group information.
	OriginGroups []*OriginGroup `json:"OriginGroups,omitnil,omitempty" name:"OriginGroups"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeOriginProtectionRequest 

type DescribeOriginProtectionRequest struct {
	*tchttp.BaseRequest

	// Set of site IDs to be queried. This is a required parameter.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// Filter conditions. Each filter condition can have up to 20 entries. See below for details:
	// <li>`need-update`:<br>   Whether <strong>the intermediate IP update is needed for the site</strong>.<br>   Type: String<br>   Required: No<br>   Values:<br>   `true`: Update needed.<br>   `false`: Update not needed.<br></li>
	// <li>`plan-support`:<br>   Whether <strong>origin protection is supported in the plan</strong>.<br>   Type: String<br>   Required: No<br>   Values:<br>   `true`: Origin protection supported.<br>   `false`: Origin protection not supported.<br></li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`

	// Offset for paginated queries. Default value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Limit on paginated queries. Default value: 20. Maximum value: 1000.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`
}

func NewDescribeOriginProtectionRequest 

func NewDescribeOriginProtectionRequest() (request *DescribeOriginProtectionRequest)

func (*DescribeOriginProtectionRequest) FromJsonString 

func (r *DescribeOriginProtectionRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeOriginProtectionRequest) ToJsonString 

func (r *DescribeOriginProtectionRequest) ToJsonString() string

type DescribeOriginProtectionRequestParams 

type DescribeOriginProtectionRequestParams struct {
	// Set of site IDs to be queried. This is a required parameter.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// Filter conditions. Each filter condition can have up to 20 entries. See below for details:
	// <li>`need-update`:<br>   Whether <strong>the intermediate IP update is needed for the site</strong>.<br>   Type: String<br>   Required: No<br>   Values:<br>   `true`: Update needed.<br>   `false`: Update not needed.<br></li>
	// <li>`plan-support`:<br>   Whether <strong>origin protection is supported in the plan</strong>.<br>   Type: String<br>   Required: No<br>   Values:<br>   `true`: Origin protection supported.<br>   `false`: Origin protection not supported.<br></li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`

	// Offset for paginated queries. Default value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Limit on paginated queries. Default value: 20. Maximum value: 1000.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`
}

Predefined struct for user

type DescribeOriginProtectionResponse 

type DescribeOriginProtectionResponse struct {
	*tchttp.BaseResponse
	Response *DescribeOriginProtectionResponseParams `json:"Response"`
}

func NewDescribeOriginProtectionResponse 

func NewDescribeOriginProtectionResponse() (response *DescribeOriginProtectionResponse)

func (*DescribeOriginProtectionResponse) FromJsonString 

func (r *DescribeOriginProtectionResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeOriginProtectionResponse) ToJsonString 

func (r *DescribeOriginProtectionResponse) ToJsonString() string

type DescribeOriginProtectionResponseParams 

type DescribeOriginProtectionResponseParams struct {
	// Origin protection configuration.
	// Note: This field may return `null`, indicating that no valid values can be obtained.
	OriginProtectionInfo []*OriginProtectionInfo `json:"OriginProtectionInfo,omitnil,omitempty" name:"OriginProtectionInfo"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeOverviewL7DataRequest 

type DescribeOverviewL7DataRequest struct {
	*tchttp.BaseRequest

	// Start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// End time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// Queried metric. Valid values:
	// <li>l7Flow_outFlux: EdgeOne response traffic;</li>
	// <li>l7Flow_inFlux: EdgeOne request traffic;</li>
	// <li>l7Flow_outBandwidth: EdgeOne response bandwidth;</li>
	// <li>l7Flow_inBandwidth: EdgeOne request traffic;</li>
	// <li>l7Flow_hit_outFlux: cache hit traffic;</li>
	// <li>l7Flow_request: number of access requests;</li>
	// <li>l7Flow_flux: upstream and downstream traffic of access requests;</li>
	// <li>l7Flow_bandwidth: upstream and downstream bandwidths of access requests.</li>
	MetricNames []*string `json:"MetricNames,omitnil,omitempty" name:"MetricNames"`

	// Site ID set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// Queried domain name set. This parameter has been deprecated.
	Domains []*string `json:"Domains,omitnil,omitempty" name:"Domains"`

	// Protocol type of the query. Valid values:
	// <li>http: HTTP protocol;</li>
	// <li>https: HTTPS protocol;</li>
	// <li>http2: HTTP/2 protocol;</li>
	// <li>all: all protocols.</li>If this parameter is not input, the default value `all` is used. This parameter is not yet effective.
	Protocol *string `json:"Protocol,omitnil,omitempty" name:"Protocol"`

	// Time granularity of the query. Valid values:
	// <li>min: 1 minute;</li>
	// <li>5min: 5 minutes;</li>
	// <li>hour: 1 hour;</li>
	// <li>day: 1 day.</li>If this parameter is not input, the granularity will be automatically inferred based on the interval between the start time and end time. Specifically, the granularity value is min, 5min, hour, and day respectively for queries of data within 1 hour, within 2 days, within 7 days, and over 7 days.
	Interval *string `json:"Interval,omitnil,omitempty" name:"Interval"`

	// Filter criteria. The detailed Key values of filter criteria are as follows:
	// <li>socket:<br>   Filter by [<strong>HTTP protocol type</strong>].<br>   Valid values:<br>   HTTP: HTTP protocol; <br>   HTTPS: HTTPS protocol;<br>   QUIC: QUIC protocol.</li>
	// <li>domain<br>?? Filter by [<strong>domain name</strong>].</li>
	// <li>tagKey<br>?? Filter by [<strong>tag key</strong>].</li>
	// <li>tagValue<br>?? Filter by [<strong>tag value</strong>].</li>
	Filters []*QueryCondition `json:"Filters,omitnil,omitempty" name:"Filters"`

	// Data ownership area. Valid values:
	// <li>overseas: global (excluding the Chinese mainland) data;</li>
	// <li>mainland: Chinese mainland data;</li>
	// <li>global: global data.</li>If this parameter is not input, the default value `global` is used.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`
}

func NewDescribeOverviewL7DataRequest 

func NewDescribeOverviewL7DataRequest() (request *DescribeOverviewL7DataRequest)

func (*DescribeOverviewL7DataRequest) FromJsonString 

func (r *DescribeOverviewL7DataRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeOverviewL7DataRequest) ToJsonString 

func (r *DescribeOverviewL7DataRequest) ToJsonString() string

type DescribeOverviewL7DataRequestParams 

type DescribeOverviewL7DataRequestParams struct {
	// Start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// End time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// Queried metric. Valid values:
	// <li>l7Flow_outFlux: EdgeOne response traffic;</li>
	// <li>l7Flow_inFlux: EdgeOne request traffic;</li>
	// <li>l7Flow_outBandwidth: EdgeOne response bandwidth;</li>
	// <li>l7Flow_inBandwidth: EdgeOne request traffic;</li>
	// <li>l7Flow_hit_outFlux: cache hit traffic;</li>
	// <li>l7Flow_request: number of access requests;</li>
	// <li>l7Flow_flux: upstream and downstream traffic of access requests;</li>
	// <li>l7Flow_bandwidth: upstream and downstream bandwidths of access requests.</li>
	MetricNames []*string `json:"MetricNames,omitnil,omitempty" name:"MetricNames"`

	// Site ID set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// Queried domain name set. This parameter has been deprecated.
	Domains []*string `json:"Domains,omitnil,omitempty" name:"Domains"`

	// Protocol type of the query. Valid values:
	// <li>http: HTTP protocol;</li>
	// <li>https: HTTPS protocol;</li>
	// <li>http2: HTTP/2 protocol;</li>
	// <li>all: all protocols.</li>If this parameter is not input, the default value `all` is used. This parameter is not yet effective.
	Protocol *string `json:"Protocol,omitnil,omitempty" name:"Protocol"`

	// Time granularity of the query. Valid values:
	// <li>min: 1 minute;</li>
	// <li>5min: 5 minutes;</li>
	// <li>hour: 1 hour;</li>
	// <li>day: 1 day.</li>If this parameter is not input, the granularity will be automatically inferred based on the interval between the start time and end time. Specifically, the granularity value is min, 5min, hour, and day respectively for queries of data within 1 hour, within 2 days, within 7 days, and over 7 days.
	Interval *string `json:"Interval,omitnil,omitempty" name:"Interval"`

	// Filter criteria. The detailed Key values of filter criteria are as follows:
	// <li>socket:<br>   Filter by [<strong>HTTP protocol type</strong>].<br>   Valid values:<br>   HTTP: HTTP protocol; <br>   HTTPS: HTTPS protocol;<br>   QUIC: QUIC protocol.</li>
	// <li>domain<br>?? Filter by [<strong>domain name</strong>].</li>
	// <li>tagKey<br>?? Filter by [<strong>tag key</strong>].</li>
	// <li>tagValue<br>?? Filter by [<strong>tag value</strong>].</li>
	Filters []*QueryCondition `json:"Filters,omitnil,omitempty" name:"Filters"`

	// Data ownership area. Valid values:
	// <li>overseas: global (excluding the Chinese mainland) data;</li>
	// <li>mainland: Chinese mainland data;</li>
	// <li>global: global data.</li>If this parameter is not input, the default value `global` is used.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`
}

Predefined struct for user

type DescribeOverviewL7DataResponse 

type DescribeOverviewL7DataResponse struct {
	*tchttp.BaseResponse
	Response *DescribeOverviewL7DataResponseParams `json:"Response"`
}

func NewDescribeOverviewL7DataResponse 

func NewDescribeOverviewL7DataResponse() (response *DescribeOverviewL7DataResponse)

func (*DescribeOverviewL7DataResponse) FromJsonString 

func (r *DescribeOverviewL7DataResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeOverviewL7DataResponse) ToJsonString 

func (r *DescribeOverviewL7DataResponse) ToJsonString() string

type DescribeOverviewL7DataResponseParams 

type DescribeOverviewL7DataResponseParams struct {
	// Total number of entries in the query result.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// List of time series traffic data in L7 monitoring.
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	Data []*TimingDataRecord `json:"Data,omitnil,omitempty" name:"Data"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribePrefetchTasksRequest 

type DescribePrefetchTasksRequest struct {
	*tchttp.BaseRequest

	// Site ID. This parameter is required.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Start time of the query. Either time or job-id is required.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// End time of the query. Either time or job-id is required.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// Offset of paginated query. Default value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Number limit of paginated query. Default value: 20. Maximum value: 1000.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter criteria. The maximum number of Filters.Values is 20. The detailed filter criteria are as follows: <li>job-id: Filter by task ID in the format like 1379afjk91u32h. Multiple values and fuzzy queries are not supported.</li><li>target: Filter by target resource information in the format like http://www.qq.com/1.txt. Multiple values and fuzzy queries are not supported.</li><li>domains: Filter by domain name in the format like www.qq.com. Fuzzy queries are not supported.</li><li>statuses: Filter by task status. Fuzzy queries are not supported. Options:<br>??processing: processing<br>??success: successful<br>??failed: failed<br>??timeout: timed out<br>??invalid: invalid, that is, the response status code of the origin server is not 2xx. Please check the origin server service.</li>
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

func NewDescribePrefetchTasksRequest 

func NewDescribePrefetchTasksRequest() (request *DescribePrefetchTasksRequest)

func (*DescribePrefetchTasksRequest) FromJsonString 

func (r *DescribePrefetchTasksRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribePrefetchTasksRequest) ToJsonString 

func (r *DescribePrefetchTasksRequest) ToJsonString() string

type DescribePrefetchTasksRequestParams 

type DescribePrefetchTasksRequestParams struct {
	// Site ID. This parameter is required.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Start time of the query. Either time or job-id is required.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// End time of the query. Either time or job-id is required.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// Offset of paginated query. Default value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Number limit of paginated query. Default value: 20. Maximum value: 1000.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter criteria. The maximum number of Filters.Values is 20. The detailed filter criteria are as follows: <li>job-id: Filter by task ID in the format like 1379afjk91u32h. Multiple values and fuzzy queries are not supported.</li><li>target: Filter by target resource information in the format like http://www.qq.com/1.txt. Multiple values and fuzzy queries are not supported.</li><li>domains: Filter by domain name in the format like www.qq.com. Fuzzy queries are not supported.</li><li>statuses: Filter by task status. Fuzzy queries are not supported. Options:<br>??processing: processing<br>??success: successful<br>??failed: failed<br>??timeout: timed out<br>??invalid: invalid, that is, the response status code of the origin server is not 2xx. Please check the origin server service.</li>
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

Predefined struct for user

type DescribePrefetchTasksResponse 

type DescribePrefetchTasksResponse struct {
	*tchttp.BaseResponse
	Response *DescribePrefetchTasksResponseParams `json:"Response"`
}

func NewDescribePrefetchTasksResponse 

func NewDescribePrefetchTasksResponse() (response *DescribePrefetchTasksResponse)

func (*DescribePrefetchTasksResponse) FromJsonString 

func (r *DescribePrefetchTasksResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribePrefetchTasksResponse) ToJsonString 

func (r *DescribePrefetchTasksResponse) ToJsonString() string

type DescribePrefetchTasksResponseParams 

type DescribePrefetchTasksResponseParams struct {
	// Total number of items in the query condition.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// Task result list.
	Tasks []*Task `json:"Tasks,omitnil,omitempty" name:"Tasks"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribePurgeTasksRequest 

type DescribePurgeTasksRequest struct {
	*tchttp.BaseRequest

	// Site ID. This parameter is required.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Start time of the query. Either time or job-id is required.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// End time of the query. Either time or job-id is required.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// Offset of paginated query. Default value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Number limit of paginated query. Default value: 20. Maximum value: 1000.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter criteria. The maximum number of Filters.Values is 20. The detailed filter criteria are as follows:
	// <li>job-id: Filter by task ID in the format like 1379afjk91u32h. Multiple values and fuzzy queries are not supported.</li>
	// <li>target: Filter by target resource information in the format like http://www.qq.com/1.txt or tag1. Multiple values are not supported yet. Fuzzy queries are supported.</li>
	// <li>domains: Filter by domain name in the format like www.qq.com. Fuzzy queries are not supported.</li>
	// <li>statuses: Filter by task status. Fuzzy queries are not supported. Options:<br>?? processing: processing<br>?? success: successful<br>?? failed: failed<br>?? timeout: timed out</li>
	// <li>type: Filter by cache clearance type. Multiple values and fuzzy queries are not supported yet. Options: <br>?? purge_url: URL<br>?? purge_prefix: prefix<br>?? purge_all: all cached content<br>?? purge_host: Hostname<br>?? purge_cache_tag: CacheTag</li>
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

func NewDescribePurgeTasksRequest 

func NewDescribePurgeTasksRequest() (request *DescribePurgeTasksRequest)

func (*DescribePurgeTasksRequest) FromJsonString 

func (r *DescribePurgeTasksRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribePurgeTasksRequest) ToJsonString 

func (r *DescribePurgeTasksRequest) ToJsonString() string

type DescribePurgeTasksRequestParams 

type DescribePurgeTasksRequestParams struct {
	// Site ID. This parameter is required.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Start time of the query. Either time or job-id is required.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// End time of the query. Either time or job-id is required.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// Offset of paginated query. Default value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Number limit of paginated query. Default value: 20. Maximum value: 1000.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter criteria. The maximum number of Filters.Values is 20. The detailed filter criteria are as follows:
	// <li>job-id: Filter by task ID in the format like 1379afjk91u32h. Multiple values and fuzzy queries are not supported.</li>
	// <li>target: Filter by target resource information in the format like http://www.qq.com/1.txt or tag1. Multiple values are not supported yet. Fuzzy queries are supported.</li>
	// <li>domains: Filter by domain name in the format like www.qq.com. Fuzzy queries are not supported.</li>
	// <li>statuses: Filter by task status. Fuzzy queries are not supported. Options:<br>?? processing: processing<br>?? success: successful<br>?? failed: failed<br>?? timeout: timed out</li>
	// <li>type: Filter by cache clearance type. Multiple values and fuzzy queries are not supported yet. Options: <br>?? purge_url: URL<br>?? purge_prefix: prefix<br>?? purge_all: all cached content<br>?? purge_host: Hostname<br>?? purge_cache_tag: CacheTag</li>
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

Predefined struct for user

type DescribePurgeTasksResponse 

type DescribePurgeTasksResponse struct {
	*tchttp.BaseResponse
	Response *DescribePurgeTasksResponseParams `json:"Response"`
}

func NewDescribePurgeTasksResponse 

func NewDescribePurgeTasksResponse() (response *DescribePurgeTasksResponse)

func (*DescribePurgeTasksResponse) FromJsonString 

func (r *DescribePurgeTasksResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribePurgeTasksResponse) ToJsonString 

func (r *DescribePurgeTasksResponse) ToJsonString() string

type DescribePurgeTasksResponseParams 

type DescribePurgeTasksResponseParams struct {
	// Total number of items in the query condition.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// Task result list.
	Tasks []*Task `json:"Tasks,omitnil,omitempty" name:"Tasks"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeRealtimeLogDeliveryTasksRequest 

type DescribeRealtimeLogDeliveryTasksRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The offset of paginated query. Default value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// The limit of paginated query. Default value: 20. Maximum value: 1000.
	Limit *uint64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter conditions. The maximum value for Filters.Values is 20. If this field is not filled in, all the real-time log delivery task information under the current zone-id will be returned. Detailed filter conditions are as follows:
	// <li>task-id: Filter by real-time log delivery task ID. Fuzzy search is not supported.</li>
	// <li>task-name: Filter by real-time log delivery task name. Fuzzy search is supported, but only one real-time log delivery task name can be filled in for fuzzy search.</li>
	// <li>entity-list: Filter by entity corresponding to the real-time log delivery task. Fuzzy search is not supported. Example values: domain.example.com or sid-2s69eb5wcms7.</li>
	// <li>task-type: Filter by real-time log delivery task type. Fuzzy search is not supported. Optional values:<br>cls: Push to Tencent Cloud CLS;<br>custom_endpoint: Push to a user-defined HTTP(S) address;<br>s3: Push to an AWS S3-compatible bucket address.</li>
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

func NewDescribeRealtimeLogDeliveryTasksRequest 

func NewDescribeRealtimeLogDeliveryTasksRequest() (request *DescribeRealtimeLogDeliveryTasksRequest)

func (*DescribeRealtimeLogDeliveryTasksRequest) FromJsonString 

func (r *DescribeRealtimeLogDeliveryTasksRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeRealtimeLogDeliveryTasksRequest) ToJsonString 

func (r *DescribeRealtimeLogDeliveryTasksRequest) ToJsonString() string

type DescribeRealtimeLogDeliveryTasksRequestParams 

type DescribeRealtimeLogDeliveryTasksRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The offset of paginated query. Default value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// The limit of paginated query. Default value: 20. Maximum value: 1000.
	Limit *uint64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter conditions. The maximum value for Filters.Values is 20. If this field is not filled in, all the real-time log delivery task information under the current zone-id will be returned. Detailed filter conditions are as follows:
	// <li>task-id: Filter by real-time log delivery task ID. Fuzzy search is not supported.</li>
	// <li>task-name: Filter by real-time log delivery task name. Fuzzy search is supported, but only one real-time log delivery task name can be filled in for fuzzy search.</li>
	// <li>entity-list: Filter by entity corresponding to the real-time log delivery task. Fuzzy search is not supported. Example values: domain.example.com or sid-2s69eb5wcms7.</li>
	// <li>task-type: Filter by real-time log delivery task type. Fuzzy search is not supported. Optional values:<br>cls: Push to Tencent Cloud CLS;<br>custom_endpoint: Push to a user-defined HTTP(S) address;<br>s3: Push to an AWS S3-compatible bucket address.</li>
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

Predefined struct for user

type DescribeRealtimeLogDeliveryTasksResponse 

type DescribeRealtimeLogDeliveryTasksResponse struct {
	*tchttp.BaseResponse
	Response *DescribeRealtimeLogDeliveryTasksResponseParams `json:"Response"`
}

func NewDescribeRealtimeLogDeliveryTasksResponse 

func NewDescribeRealtimeLogDeliveryTasksResponse() (response *DescribeRealtimeLogDeliveryTasksResponse)

func (*DescribeRealtimeLogDeliveryTasksResponse) FromJsonString 

func (r *DescribeRealtimeLogDeliveryTasksResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeRealtimeLogDeliveryTasksResponse) ToJsonString 

func (r *DescribeRealtimeLogDeliveryTasksResponse) ToJsonString() string

type DescribeRealtimeLogDeliveryTasksResponseParams 

type DescribeRealtimeLogDeliveryTasksResponseParams struct {
	// The number of real-time log delivery tasks which match the query conditions.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// The list of all real-time log delivery tasks which match the query conditions.
	RealtimeLogDeliveryTasks []*RealtimeLogDeliveryTask `json:"RealtimeLogDeliveryTasks,omitnil,omitempty" name:"RealtimeLogDeliveryTasks"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeRulesRequest 

type DescribeRulesRequest struct {
	*tchttp.BaseRequest

	// ID of the site
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Filter conditions. Each filter condition can have up to 20 entries. See below for details:
	// <li>`rule-id`:<br>   Filter by the <strong>rule ID</strong><br>   Type: String<br>   Required: No</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

func NewDescribeRulesRequest 

func NewDescribeRulesRequest() (request *DescribeRulesRequest)

func (*DescribeRulesRequest) FromJsonString 

func (r *DescribeRulesRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeRulesRequest) ToJsonString 

func (r *DescribeRulesRequest) ToJsonString() string

type DescribeRulesRequestParams 

type DescribeRulesRequestParams struct {
	// ID of the site
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Filter conditions. Each filter condition can have up to 20 entries. See below for details:
	// <li>`rule-id`:<br>   Filter by the <strong>rule ID</strong><br>   Type: String<br>   Required: No</li>
	Filters []*Filter `json:"Filters,omitnil,omitempty" name:"Filters"`
}

Predefined struct for user

type DescribeRulesResponse 

type DescribeRulesResponse struct {
	*tchttp.BaseResponse
	Response *DescribeRulesResponseParams `json:"Response"`
}

func NewDescribeRulesResponse 

func NewDescribeRulesResponse() (response *DescribeRulesResponse)

func (*DescribeRulesResponse) FromJsonString 

func (r *DescribeRulesResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeRulesResponse) ToJsonString 

func (r *DescribeRulesResponse) ToJsonString() string

type DescribeRulesResponseParams 

type DescribeRulesResponseParams struct {
	// ID of the site
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// List of rules. Rules are sorted in order of execution.
	RuleItems []*RuleItem `json:"RuleItems,omitnil,omitempty" name:"RuleItems"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeRulesSettingRequest 

type DescribeRulesSettingRequest struct {
	*tchttp.BaseRequest
}

func NewDescribeRulesSettingRequest 

func NewDescribeRulesSettingRequest() (request *DescribeRulesSettingRequest)

func (*DescribeRulesSettingRequest) FromJsonString 

func (r *DescribeRulesSettingRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeRulesSettingRequest) ToJsonString 

func (r *DescribeRulesSettingRequest) ToJsonString() string

type DescribeRulesSettingRequestParams 

type DescribeRulesSettingRequestParams struct {
}

Predefined struct for user

type DescribeRulesSettingResponse 

type DescribeRulesSettingResponse struct {
	*tchttp.BaseResponse
	Response *DescribeRulesSettingResponseParams `json:"Response"`
}

func NewDescribeRulesSettingResponse 

func NewDescribeRulesSettingResponse() (response *DescribeRulesSettingResponse)

func (*DescribeRulesSettingResponse) FromJsonString 

func (r *DescribeRulesSettingResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeRulesSettingResponse) ToJsonString 

func (r *DescribeRulesSettingResponse) ToJsonString() string

type DescribeRulesSettingResponseParams 

type DescribeRulesSettingResponseParams struct {
	// List of the settings of the rule engine that can be used for request match and their detailed recommended configuration information.
	Actions []*RulesSettingAction `json:"Actions,omitnil,omitempty" name:"Actions"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeSecurityIPGroupInfoRequest 

type DescribeSecurityIPGroupInfoRequest struct {
	*tchttp.BaseRequest

	// Site ID, used to specify the query scope.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Maximum number of entries returned in a single response. Default value: 20. Maximum query entries: 1000.
	Limit *uint64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// The starting entry offset for pagination queries. The default value is 0.
	Offset *uint64 `json:"Offset,omitnil,omitempty" name:"Offset"`
}

func NewDescribeSecurityIPGroupInfoRequest 

func NewDescribeSecurityIPGroupInfoRequest() (request *DescribeSecurityIPGroupInfoRequest)

func (*DescribeSecurityIPGroupInfoRequest) FromJsonString 

func (r *DescribeSecurityIPGroupInfoRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeSecurityIPGroupInfoRequest) ToJsonString 

func (r *DescribeSecurityIPGroupInfoRequest) ToJsonString() string

type DescribeSecurityIPGroupInfoRequestParams 

type DescribeSecurityIPGroupInfoRequestParams struct {
	// Site ID, used to specify the query scope.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Maximum number of entries returned in a single response. Default value: 20. Maximum query entries: 1000.
	Limit *uint64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// The starting entry offset for pagination queries. The default value is 0.
	Offset *uint64 `json:"Offset,omitnil,omitempty" name:"Offset"`
}

Predefined struct for user

type DescribeSecurityIPGroupInfoResponse 

type DescribeSecurityIPGroupInfoResponse struct {
	*tchttp.BaseResponse
	Response *DescribeSecurityIPGroupInfoResponseParams `json:"Response"`
}

func NewDescribeSecurityIPGroupInfoResponse 

func NewDescribeSecurityIPGroupInfoResponse() (response *DescribeSecurityIPGroupInfoResponse)

func (*DescribeSecurityIPGroupInfoResponse) FromJsonString 

func (r *DescribeSecurityIPGroupInfoResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeSecurityIPGroupInfoResponse) ToJsonString 

func (r *DescribeSecurityIPGroupInfoResponse) ToJsonString() string

type DescribeSecurityIPGroupInfoResponseParams 

type DescribeSecurityIPGroupInfoResponseParams struct {
	// The number of IP groups that meet the conditions.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// Detailed configuration information of the IP group, including the ID, name, and IP/network segment list of each IP group.
	IPGroups []*IPGroup `json:"IPGroups,omitnil,omitempty" name:"IPGroups"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeSecurityIPGroupRequest 

type DescribeSecurityIPGroupRequest struct {
	*tchttp.BaseRequest

	// Site ID, used to specify the scope of the queried site.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Specifies the ID of a security IP group.
	// <li>When this parameter is provided, only the configuration of the security IP group with the specified ID is queried.</li>
	// <li>When this parameter is not provided, information of all security IP groups under the site is returned.</li>
	GroupIds []*int64 `json:"GroupIds,omitnil,omitempty" name:"GroupIds"`
}

func NewDescribeSecurityIPGroupRequest 

func NewDescribeSecurityIPGroupRequest() (request *DescribeSecurityIPGroupRequest)

func (*DescribeSecurityIPGroupRequest) FromJsonString 

func (r *DescribeSecurityIPGroupRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeSecurityIPGroupRequest) ToJsonString 

func (r *DescribeSecurityIPGroupRequest) ToJsonString() string

type DescribeSecurityIPGroupRequestParams 

type DescribeSecurityIPGroupRequestParams struct {
	// Site ID, used to specify the scope of the queried site.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Specifies the ID of a security IP group.
	// <li>When this parameter is provided, only the configuration of the security IP group with the specified ID is queried.</li>
	// <li>When this parameter is not provided, information of all security IP groups under the site is returned.</li>
	GroupIds []*int64 `json:"GroupIds,omitnil,omitempty" name:"GroupIds"`
}

Predefined struct for user

type DescribeSecurityIPGroupResponse 

type DescribeSecurityIPGroupResponse struct {
	*tchttp.BaseResponse
	Response *DescribeSecurityIPGroupResponseParams `json:"Response"`
}

func NewDescribeSecurityIPGroupResponse 

func NewDescribeSecurityIPGroupResponse() (response *DescribeSecurityIPGroupResponse)

func (*DescribeSecurityIPGroupResponse) FromJsonString 

func (r *DescribeSecurityIPGroupResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeSecurityIPGroupResponse) ToJsonString 

func (r *DescribeSecurityIPGroupResponse) ToJsonString() string

type DescribeSecurityIPGroupResponseParams 

type DescribeSecurityIPGroupResponseParams struct {
	// Detailed configuration information of security IP groups, including the ID, name, and IP/IP range list information of each security IP group.
	IPGroups []*IPGroup `json:"IPGroups,omitnil,omitempty" name:"IPGroups"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeSecurityTemplateBindingsRequest 

type DescribeSecurityTemplateBindingsRequest struct {
	*tchttp.BaseRequest

	// ID of the site to query
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// ID of the policy template to query.
	TemplateId []*string `json:"TemplateId,omitnil,omitempty" name:"TemplateId"`
}

func NewDescribeSecurityTemplateBindingsRequest 

func NewDescribeSecurityTemplateBindingsRequest() (request *DescribeSecurityTemplateBindingsRequest)

func (*DescribeSecurityTemplateBindingsRequest) FromJsonString 

func (r *DescribeSecurityTemplateBindingsRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeSecurityTemplateBindingsRequest) ToJsonString 

func (r *DescribeSecurityTemplateBindingsRequest) ToJsonString() string

type DescribeSecurityTemplateBindingsRequestParams 

type DescribeSecurityTemplateBindingsRequestParams struct {
	// ID of the site to query
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// ID of the policy template to query.
	TemplateId []*string `json:"TemplateId,omitnil,omitempty" name:"TemplateId"`
}

Predefined struct for user

type DescribeSecurityTemplateBindingsResponse 

type DescribeSecurityTemplateBindingsResponse struct {
	*tchttp.BaseResponse
	Response *DescribeSecurityTemplateBindingsResponseParams `json:"Response"`
}

func NewDescribeSecurityTemplateBindingsResponse 

func NewDescribeSecurityTemplateBindingsResponse() (response *DescribeSecurityTemplateBindingsResponse)

func (*DescribeSecurityTemplateBindingsResponse) FromJsonString 

func (r *DescribeSecurityTemplateBindingsResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeSecurityTemplateBindingsResponse) ToJsonString 

func (r *DescribeSecurityTemplateBindingsResponse) ToJsonString() string

type DescribeSecurityTemplateBindingsResponseParams 

type DescribeSecurityTemplateBindingsResponseParams struct {
	// Bindings of the specified policy template.
	//
	// When a domain name of a site is bound with the specified policy template, `TemplateScope` includes the `ZoneId` of the related site and the bindings of the domain name.
	//
	// Note: If the template is not bound with any domain name, and there is not any existing binding, `TemplateScope=0` is returned.
	//
	// In the binding list, the same domain name may appear repeatedly in the `EntityStatus` list with different `Status`. For example, when a domain name is being bound to another policy template, it's marked both `online` and `pending`.
	SecurityTemplate []*SecurityTemplateBinding `json:"SecurityTemplate,omitnil,omitempty" name:"SecurityTemplate"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeTimingL4DataRequest 

type DescribeTimingL4DataRequest struct {
	*tchttp.BaseRequest

	// The start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// The end time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// Query indicator. Values:
	// <li>l4Flow_connections: Number of access connections;</li>
	// <li>l4Flow_flux: Total access traffic;</li>
	// <li>l4Flow_inFlux: Ingress access traffic;</li>
	// <li>l4Flow_outFlux: Egress access traffic. </li>
	MetricNames []*string `json:"MetricNames,omitnil,omitempty" name:"MetricNames"`

	// ZoneId set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// List of L4 proxy IDs. All L4 proxies will be selected if this field is not specified.
	ProxyIds []*string `json:"ProxyIds,omitnil,omitempty" name:"ProxyIds"`

	// The query granularity. Values:
	// <li>`min`: 1 minute;</li>
	// <li>`5min`: 5 minutes;</li>
	// <li>`hour`: 1 hour;</li>
	// <li>`day`: 1 day.</li>If this field is not specified, the granularity will be determined based on the query period. <br>Period ≤ 1 hour: `min`; <br>1 hour < Period ≤ 2 days: `5min`; <br>2 days < period ≤ 7 days: `hour`; <br>Period > 7 days: `day`.
	Interval *string `json:"Interval,omitnil,omitempty" name:"Interval"`

	// Filter criteria. The detailed Key values of filter criteria are as follows:
	// <li>ruleId: Filter by forwarding rule ID.</li>
	// <li>proxyId: Filter by L4 proxy instance ID.</li>
	Filters []*QueryCondition `json:"Filters,omitnil,omitempty" name:"Filters"`

	// Geolocation scope. Values:
	// <li>`overseas`: Regions outside the Chinese mainland</li>
	// <li>`mainland`: Chinese mainland</li>
	// <li>`global`: Global</li>If this field is not specified, the default value `global` is used.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`
}

func NewDescribeTimingL4DataRequest 

func NewDescribeTimingL4DataRequest() (request *DescribeTimingL4DataRequest)

func (*DescribeTimingL4DataRequest) FromJsonString 

func (r *DescribeTimingL4DataRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeTimingL4DataRequest) ToJsonString 

func (r *DescribeTimingL4DataRequest) ToJsonString() string

type DescribeTimingL4DataRequestParams 

type DescribeTimingL4DataRequestParams struct {
	// The start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// The end time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// Query indicator. Values:
	// <li>l4Flow_connections: Number of access connections;</li>
	// <li>l4Flow_flux: Total access traffic;</li>
	// <li>l4Flow_inFlux: Ingress access traffic;</li>
	// <li>l4Flow_outFlux: Egress access traffic. </li>
	MetricNames []*string `json:"MetricNames,omitnil,omitempty" name:"MetricNames"`

	// ZoneId set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// List of L4 proxy IDs. All L4 proxies will be selected if this field is not specified.
	ProxyIds []*string `json:"ProxyIds,omitnil,omitempty" name:"ProxyIds"`

	// The query granularity. Values:
	// <li>`min`: 1 minute;</li>
	// <li>`5min`: 5 minutes;</li>
	// <li>`hour`: 1 hour;</li>
	// <li>`day`: 1 day.</li>If this field is not specified, the granularity will be determined based on the query period. <br>Period ≤ 1 hour: `min`; <br>1 hour < Period ≤ 2 days: `5min`; <br>2 days < period ≤ 7 days: `hour`; <br>Period > 7 days: `day`.
	Interval *string `json:"Interval,omitnil,omitempty" name:"Interval"`

	// Filter criteria. The detailed Key values of filter criteria are as follows:
	// <li>ruleId: Filter by forwarding rule ID.</li>
	// <li>proxyId: Filter by L4 proxy instance ID.</li>
	Filters []*QueryCondition `json:"Filters,omitnil,omitempty" name:"Filters"`

	// Geolocation scope. Values:
	// <li>`overseas`: Regions outside the Chinese mainland</li>
	// <li>`mainland`: Chinese mainland</li>
	// <li>`global`: Global</li>If this field is not specified, the default value `global` is used.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`
}

Predefined struct for user

type DescribeTimingL4DataResponse 

type DescribeTimingL4DataResponse struct {
	*tchttp.BaseResponse
	Response *DescribeTimingL4DataResponseParams `json:"Response"`
}

func NewDescribeTimingL4DataResponse 

func NewDescribeTimingL4DataResponse() (response *DescribeTimingL4DataResponse)

func (*DescribeTimingL4DataResponse) FromJsonString 

func (r *DescribeTimingL4DataResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeTimingL4DataResponse) ToJsonString 

func (r *DescribeTimingL4DataResponse) ToJsonString() string

type DescribeTimingL4DataResponseParams 

type DescribeTimingL4DataResponseParams struct {
	// Total number of query results.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// The list of L4 traffic data recorded over time.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Data []*TimingDataRecord `json:"Data,omitnil,omitempty" name:"Data"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeTimingL7AnalysisDataRequest 

type DescribeTimingL7AnalysisDataRequest struct {
	*tchttp.BaseRequest

	// The start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// The end time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// Metric list. Valid values:
	// <li>l7Flow_outFlux: L7 EdgeOne response traffic;</li>
	// <li>l7Flow_inFlux: L7 client request traffic;</li>
	// <li>l7Flow_flux: L7 total access traffic (including the EdgeOne response traffic and client request traffic);</li>
	// <li>l7Flow_outBandwidth: L7 EdgeOne response bandwidth;</li>
	// <li>l7Flow_inBandwidth: L7 client request bandwidth;</li>
	// <li>l7Flow_bandwidth: L7 total access bandwidth (including the EdgeOne response bandwidth and client request bandwidth);</li>
	// <li>l7Flow_request: L7 access request count.</li>
	MetricNames []*string `json:"MetricNames,omitnil,omitempty" name:"MetricNames"`

	// Zone ID set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// Query period granularity. Valid values:
	// <li>min: 1 minute;</li>
	// <li>5min: 5 minutes;</li>
	// <li>hour: 1 hour;</li>
	// <li>day: 1 day.</li>If this parameter is not filled in, the granularity will be automatically calculated based on the interval between the start time and end time. Specifically, data will be queried with a granularity of min, 5min, hour, and day respectively when the period is no more than 2 hours, no more than 2 days, no more than 7 days, and over 7 days.
	Interval *string `json:"Interval,omitnil,omitempty" name:"Interval"`

	// Filter criteria. The detailed key values are as follows:
	// <li>country: Filter by country/region. The country/region follows the <a href="https://baike.baidu.com/item/ISO%203166-1/5269555">ISO 3166-1 alpha-2</a> standard. Example value: CN.</li>
	// <li>province: Filter by province. This parameter is supported only when the service area is the Chinese mainland. For province codes, refer to the <a href="https://intl.cloud.tencent.com/document/product/228/6316?from_cn_redirect=1#.E5.8C.BA.E5.9F.9F-.2F-.E8.BF.90.E8.90.A5.E5.95.86.E6.98.A0.E5.B0.84.E8.A1.A8">Mapping Table of Provinces Within the Chinese Mainland</a>. Example value: 22.</li>
	// <li>isp: Filter by ISP. This parameter is supported only when the service area is the Chinese mainland. Valid values are as follows:<br> 2: China Telecom;<br> 26: China Unicom;<br> 1046: China Mobile;<br> 3947: China Tietong;<br> 38: CERNET;<br> 43: Great Wall Broadband;<br> 0: other ISPs.</li>
	// <li>domain: Filter by subdomain name. Example value: www.example.com.</li>
	// <li>url: Filter by URL path. Example value: /content or /content/test.jpg. If the url parameter is input, up to 30 days of data can be queried.</li>
	// <li>referer: Filter by Referer request header. Example value: http://www.example.com/. If the referer parameter is input, up to 30 days of data can be queried.</li>
	// <li>resourceType: Filter by resource type, which is generally the file suffix. Example value: .jpg. If the resourceType parameter is input, up to 30 days of data can be queried;</li>
	// <li>protocol: Filter by HTTP protocol version. Valid values are as follows:<br> HTTP/1.0;<br> HTTP/1.1;<br> HTTP/2.0;<br> HTTP/3;<br> WebSocket.</li><li>socket: Filter by HTTP protocol type. Valid values are as follows:<br> HTTP: HTTP protocol;<br> HTTPS: HTTPS protocol;<br> QUIC: QUIC protocol.</li>
	// <li>statusCode: Filter by edge status code. If the statusCode parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> 1XX: 1xx status code;<br> 2XX: 2xx status code;<br> 3XX: 3xx status code;<br> 4XX: 4xx status code;<br> 5XX: 5xx status code;<br> An integer within the range [0,600).</li>
	// <li>browserType: Filter by browser type. If the browserType parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> Firefox: Firefox browser;<br> Chrome: Chrome browser;<br> Safari: Safari browser;<br> Other: other browser types;<br> Empty: The browser type is empty;<br> Bot: search engine crawler;<br> MicrosoftEdge: Microsoft Edge browser;<br> IE: IE browser;<br> Opera: Opera browser;<br> QQBrowser: QQ browser;<br> LBBrowser: LB browser;<br> MaxthonBrowser: Maxthon browser;<br> SouGouBrowser: Sogou browser;<br> BIDUBrowser: Baidu browser;<br> TaoBrowser: Tao browser;<br> UBrowser: UC browser.</li>
	// <li>deviceType: Filter by device type. If the deviceType parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> TV: TV device;<br> Tablet: tablet device;<br> Mobile: mobile device;<br> Desktop: desktop device;<br> Other: other device types;<br> Empty: The device type is empty.</li>
	// <li>operatingSystemType: Filter by operating system type. If the operatingSystemType parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> Linux: Linux operating system;<br> MacOS: MacOS operating system;<br> Android: Android operating system;<br> IOS: iOS operating system;<br> Windows: Windows operating system;<br> NetBSD: NetBSD;<br> ChromiumOS: ChromiumOS;<br> Bot: search engine crawler;<br> Other: other types of operating systems;<br> Empty: The operating system is empty.</li>
	// <li>tlsVersion: Filter by TLS version. If the tlsVersion parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> TLS1.0;<br> TLS1.1;<br> TLS1.2;<br> TLS1.3.</li>
	// <li>ipVersion: Filter by IP version. Valid values are as follows:<br> 4: IPv4;<br> 6: IPv6.</li>
	// <li>cacheType: Filter by cache status. Valid values are as follows:<br> hit: The request hits the EdgeOne node cache and the resources are provided by the node cache. A partial cache hit for resources is also recorded as hit.<br> miss: The request does not hit the EdgeOne node cache and the resources are provided by the origin server.<br> dynamic: The requested resources cannot be cached or are not configured with node cache and are provided by the origin server.<br> other: unrecognizable cache status. Requests responded to by edge functions are recorded as other.</li>
	// <li>clientIp: Filter by client IP.</li>
	Filters []*QueryCondition `json:"Filters,omitnil,omitempty" name:"Filters"`

	// Data region. Valid values:
	// <li>overseas: global (excluding the Chinese mainland) data;</li>
	// <li>mainland: Chinese mainland data;</li>
	// <li>global: global data.</li>
	// If this parameter is not filled in, the default value is global.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`
}

func NewDescribeTimingL7AnalysisDataRequest 

func NewDescribeTimingL7AnalysisDataRequest() (request *DescribeTimingL7AnalysisDataRequest)

func (*DescribeTimingL7AnalysisDataRequest) FromJsonString 

func (r *DescribeTimingL7AnalysisDataRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeTimingL7AnalysisDataRequest) ToJsonString 

func (r *DescribeTimingL7AnalysisDataRequest) ToJsonString() string

type DescribeTimingL7AnalysisDataRequestParams 

type DescribeTimingL7AnalysisDataRequestParams struct {
	// The start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// The end time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// Metric list. Valid values:
	// <li>l7Flow_outFlux: L7 EdgeOne response traffic;</li>
	// <li>l7Flow_inFlux: L7 client request traffic;</li>
	// <li>l7Flow_flux: L7 total access traffic (including the EdgeOne response traffic and client request traffic);</li>
	// <li>l7Flow_outBandwidth: L7 EdgeOne response bandwidth;</li>
	// <li>l7Flow_inBandwidth: L7 client request bandwidth;</li>
	// <li>l7Flow_bandwidth: L7 total access bandwidth (including the EdgeOne response bandwidth and client request bandwidth);</li>
	// <li>l7Flow_request: L7 access request count.</li>
	MetricNames []*string `json:"MetricNames,omitnil,omitempty" name:"MetricNames"`

	// Zone ID set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// Query period granularity. Valid values:
	// <li>min: 1 minute;</li>
	// <li>5min: 5 minutes;</li>
	// <li>hour: 1 hour;</li>
	// <li>day: 1 day.</li>If this parameter is not filled in, the granularity will be automatically calculated based on the interval between the start time and end time. Specifically, data will be queried with a granularity of min, 5min, hour, and day respectively when the period is no more than 2 hours, no more than 2 days, no more than 7 days, and over 7 days.
	Interval *string `json:"Interval,omitnil,omitempty" name:"Interval"`

	// Filter criteria. The detailed key values are as follows:
	// <li>country: Filter by country/region. The country/region follows the <a href="https://baike.baidu.com/item/ISO%203166-1/5269555">ISO 3166-1 alpha-2</a> standard. Example value: CN.</li>
	// <li>province: Filter by province. This parameter is supported only when the service area is the Chinese mainland. For province codes, refer to the <a href="https://intl.cloud.tencent.com/document/product/228/6316?from_cn_redirect=1#.E5.8C.BA.E5.9F.9F-.2F-.E8.BF.90.E8.90.A5.E5.95.86.E6.98.A0.E5.B0.84.E8.A1.A8">Mapping Table of Provinces Within the Chinese Mainland</a>. Example value: 22.</li>
	// <li>isp: Filter by ISP. This parameter is supported only when the service area is the Chinese mainland. Valid values are as follows:<br> 2: China Telecom;<br> 26: China Unicom;<br> 1046: China Mobile;<br> 3947: China Tietong;<br> 38: CERNET;<br> 43: Great Wall Broadband;<br> 0: other ISPs.</li>
	// <li>domain: Filter by subdomain name. Example value: www.example.com.</li>
	// <li>url: Filter by URL path. Example value: /content or /content/test.jpg. If the url parameter is input, up to 30 days of data can be queried.</li>
	// <li>referer: Filter by Referer request header. Example value: http://www.example.com/. If the referer parameter is input, up to 30 days of data can be queried.</li>
	// <li>resourceType: Filter by resource type, which is generally the file suffix. Example value: .jpg. If the resourceType parameter is input, up to 30 days of data can be queried;</li>
	// <li>protocol: Filter by HTTP protocol version. Valid values are as follows:<br> HTTP/1.0;<br> HTTP/1.1;<br> HTTP/2.0;<br> HTTP/3;<br> WebSocket.</li><li>socket: Filter by HTTP protocol type. Valid values are as follows:<br> HTTP: HTTP protocol;<br> HTTPS: HTTPS protocol;<br> QUIC: QUIC protocol.</li>
	// <li>statusCode: Filter by edge status code. If the statusCode parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> 1XX: 1xx status code;<br> 2XX: 2xx status code;<br> 3XX: 3xx status code;<br> 4XX: 4xx status code;<br> 5XX: 5xx status code;<br> An integer within the range [0,600).</li>
	// <li>browserType: Filter by browser type. If the browserType parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> Firefox: Firefox browser;<br> Chrome: Chrome browser;<br> Safari: Safari browser;<br> Other: other browser types;<br> Empty: The browser type is empty;<br> Bot: search engine crawler;<br> MicrosoftEdge: Microsoft Edge browser;<br> IE: IE browser;<br> Opera: Opera browser;<br> QQBrowser: QQ browser;<br> LBBrowser: LB browser;<br> MaxthonBrowser: Maxthon browser;<br> SouGouBrowser: Sogou browser;<br> BIDUBrowser: Baidu browser;<br> TaoBrowser: Tao browser;<br> UBrowser: UC browser.</li>
	// <li>deviceType: Filter by device type. If the deviceType parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> TV: TV device;<br> Tablet: tablet device;<br> Mobile: mobile device;<br> Desktop: desktop device;<br> Other: other device types;<br> Empty: The device type is empty.</li>
	// <li>operatingSystemType: Filter by operating system type. If the operatingSystemType parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> Linux: Linux operating system;<br> MacOS: MacOS operating system;<br> Android: Android operating system;<br> IOS: iOS operating system;<br> Windows: Windows operating system;<br> NetBSD: NetBSD;<br> ChromiumOS: ChromiumOS;<br> Bot: search engine crawler;<br> Other: other types of operating systems;<br> Empty: The operating system is empty.</li>
	// <li>tlsVersion: Filter by TLS version. If the tlsVersion parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> TLS1.0;<br> TLS1.1;<br> TLS1.2;<br> TLS1.3.</li>
	// <li>ipVersion: Filter by IP version. Valid values are as follows:<br> 4: IPv4;<br> 6: IPv6.</li>
	// <li>cacheType: Filter by cache status. Valid values are as follows:<br> hit: The request hits the EdgeOne node cache and the resources are provided by the node cache. A partial cache hit for resources is also recorded as hit.<br> miss: The request does not hit the EdgeOne node cache and the resources are provided by the origin server.<br> dynamic: The requested resources cannot be cached or are not configured with node cache and are provided by the origin server.<br> other: unrecognizable cache status. Requests responded to by edge functions are recorded as other.</li>
	// <li>clientIp: Filter by client IP.</li>
	Filters []*QueryCondition `json:"Filters,omitnil,omitempty" name:"Filters"`

	// Data region. Valid values:
	// <li>overseas: global (excluding the Chinese mainland) data;</li>
	// <li>mainland: Chinese mainland data;</li>
	// <li>global: global data.</li>
	// If this parameter is not filled in, the default value is global.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`
}

Predefined struct for user

type DescribeTimingL7AnalysisDataResponse 

type DescribeTimingL7AnalysisDataResponse struct {
	*tchttp.BaseResponse
	Response *DescribeTimingL7AnalysisDataResponseParams `json:"Response"`
}

func NewDescribeTimingL7AnalysisDataResponse 

func NewDescribeTimingL7AnalysisDataResponse() (response *DescribeTimingL7AnalysisDataResponse)

func (*DescribeTimingL7AnalysisDataResponse) FromJsonString 

func (r *DescribeTimingL7AnalysisDataResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeTimingL7AnalysisDataResponse) ToJsonString 

func (r *DescribeTimingL7AnalysisDataResponse) ToJsonString() string

type DescribeTimingL7AnalysisDataResponseParams 

type DescribeTimingL7AnalysisDataResponseParams struct {
	// Total number of query results.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// The list of L7 traffic data recorded over time.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Data []*TimingDataRecord `json:"Data,omitnil,omitempty" name:"Data"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeTimingL7CacheDataRequest 

type DescribeTimingL7CacheDataRequest struct {
	*tchttp.BaseRequest

	// The start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// The end time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// The query metric. Values:
	// <li>l7Cache_outFlux: Response traffic.</li>
	// <li>l7Cache_request: Response requests.</li>
	// <li>l7Cache_outBandwidth: Response bandwidth.</li>
	MetricNames []*string `json:"MetricNames,omitnil,omitempty" name:"MetricNames"`

	// ZoneId set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// Filter conditions. See below for details:
	// <li>`domain`<br> Filter by the <strong>sub-domain name</strong>, such as `test.example.com`<br> Type: String<br> Required: No</li>
	// <li>`url`<br> Filter by the <strong>URL</strong>, such as `/content`. The query period cannot exceed 30 days. <br> Type: String<br> Required: No</li>
	// <li>`resourceType`<br> Filter by the <strong>resource file type</strong>, such as `jpg`, `png`. The query period cannot exceed 30 days.<br>Type: String<br> Required: No</li>
	// <li>cacheType<br>Filter by the <strong>cache hit result</strong>.<br>Type: String<br> Required: No<br> Values: <br> `hit`: Cache hit; <br> `dynamic`: Resource non-cacheable; <br> `miss`: Cache miss</li>
	// <li>`statusCode`<br> Filter by the <strong> status code</strong>. The query period  cannot exceed 30 days. <br> Type: String<br> Required: No<br> Values: <br> `1XX`: All 1xx status codes;<br> `100`: 100 status code;<br> `101`: 101 status code;<br> `102`: 102 status code;<br> `2XX`: All 2xx status codes;<br> `200`: 200 status code;<br> `201`: 201 status code;<br> `202`: 202 status code;<br> `203`: 203 status code;<br> `204`: 204 status code;<br> `205`: 205 status code;<br> `206`: 206 status code;<br> `207`: 207 status code;<br> `3XX`: All 3xx status codes;<br> `300`: 300 status code;<br> `301`: 301 status code;<br> `302`: 302 status code;<br> `303`: 303 status code;<br> `304`: 304 status code;<br> `305`: 305 status code;<br> `307`: 307 status code;<br> `4XX`: All 4xx status codes;<br> `400`: 400 status code;<br> `401`: 401 status code;<br> `402`: 402 status code;<br> `403`: 403 status code;<br> `404`: 404 status code;<br> `405`: 405 status code;<br> `406`: 406 status code;<br> `407`: 407 status code;<br> `408`: 408 status code;<br> `409`: 409 status code;<br> `410`: 410 status code;<br> `411`: 411 status code;<br> `412`: 412 status code;<br> `412`: 413 status code;<br> `414`: 414 status code;<br> `415`: 415 status code;<br> `416`: 416 status code;<br> `417`: 417 status code;<br>`422`: 422 status code;<br> `423`: 423 status code;<br> `424`: 424 status code;<br> `426`: 426 status code;<br> `451`: 451 status code;<br> `5XX`: All 5xx status codes;<br> `500`: 500 status code;<br> `501`: 501 status code;<br> `502`: 502 status code;<br> `503`: 503 status code;<br> `504`: 504 status code;<br> `505`: 505 status code;<br> `506`: 506 status code;<br> `507`: 507 status code;<br> `510`: 510 status code;<br> `514`: 514 status code;<br> `544`: 544 status code.</li>
	// <li>`tagKey`:<br> Filter by the <strong>tag key</strong><br> Type: String<br> Required: No</li>
	// <li>`tagValue`<br> Filter by the <strong>tag value</strong><br> Type: String<br> Required: No</li>
	Filters []*QueryCondition `json:"Filters,omitnil,omitempty" name:"Filters"`

	// The query time granularity. Values:
	// <li>`min`: 1 minute;</li>
	// <li>`5min`: 5 minutes;</li>
	// <li>`hour`: 1 hour;</li>
	// <li>`day`: 1 day.</li>If this field is not specified, the granularity will be determined based on the interval between the start time and end time as follows: 1-minute granularity applies for a 1-hour interval, 5-minute granularity for a 2-day interval, 1-hour granularity for a 7-day interval, and 1-day granularity for an interval of over 7 days.
	Interval *string `json:"Interval,omitnil,omitempty" name:"Interval"`

	// Geolocation scope. Values:
	// <li>`overseas`: Regions outside the Chinese mainland</li>
	// <li>`mainland`: Chinese mainland</li>
	// <li>`global`: Global</li>If this field is not specified, the default value `global` is used.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`
}

func NewDescribeTimingL7CacheDataRequest 

func NewDescribeTimingL7CacheDataRequest() (request *DescribeTimingL7CacheDataRequest)

func (*DescribeTimingL7CacheDataRequest) FromJsonString 

func (r *DescribeTimingL7CacheDataRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeTimingL7CacheDataRequest) ToJsonString 

func (r *DescribeTimingL7CacheDataRequest) ToJsonString() string

type DescribeTimingL7CacheDataRequestParams 

type DescribeTimingL7CacheDataRequestParams struct {
	// The start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// The end time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// The query metric. Values:
	// <li>l7Cache_outFlux: Response traffic.</li>
	// <li>l7Cache_request: Response requests.</li>
	// <li>l7Cache_outBandwidth: Response bandwidth.</li>
	MetricNames []*string `json:"MetricNames,omitnil,omitempty" name:"MetricNames"`

	// ZoneId set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// Filter conditions. See below for details:
	// <li>`domain`<br> Filter by the <strong>sub-domain name</strong>, such as `test.example.com`<br> Type: String<br> Required: No</li>
	// <li>`url`<br> Filter by the <strong>URL</strong>, such as `/content`. The query period cannot exceed 30 days. <br> Type: String<br> Required: No</li>
	// <li>`resourceType`<br> Filter by the <strong>resource file type</strong>, such as `jpg`, `png`. The query period cannot exceed 30 days.<br>Type: String<br> Required: No</li>
	// <li>cacheType<br>Filter by the <strong>cache hit result</strong>.<br>Type: String<br> Required: No<br> Values: <br> `hit`: Cache hit; <br> `dynamic`: Resource non-cacheable; <br> `miss`: Cache miss</li>
	// <li>`statusCode`<br> Filter by the <strong> status code</strong>. The query period  cannot exceed 30 days. <br> Type: String<br> Required: No<br> Values: <br> `1XX`: All 1xx status codes;<br> `100`: 100 status code;<br> `101`: 101 status code;<br> `102`: 102 status code;<br> `2XX`: All 2xx status codes;<br> `200`: 200 status code;<br> `201`: 201 status code;<br> `202`: 202 status code;<br> `203`: 203 status code;<br> `204`: 204 status code;<br> `205`: 205 status code;<br> `206`: 206 status code;<br> `207`: 207 status code;<br> `3XX`: All 3xx status codes;<br> `300`: 300 status code;<br> `301`: 301 status code;<br> `302`: 302 status code;<br> `303`: 303 status code;<br> `304`: 304 status code;<br> `305`: 305 status code;<br> `307`: 307 status code;<br> `4XX`: All 4xx status codes;<br> `400`: 400 status code;<br> `401`: 401 status code;<br> `402`: 402 status code;<br> `403`: 403 status code;<br> `404`: 404 status code;<br> `405`: 405 status code;<br> `406`: 406 status code;<br> `407`: 407 status code;<br> `408`: 408 status code;<br> `409`: 409 status code;<br> `410`: 410 status code;<br> `411`: 411 status code;<br> `412`: 412 status code;<br> `412`: 413 status code;<br> `414`: 414 status code;<br> `415`: 415 status code;<br> `416`: 416 status code;<br> `417`: 417 status code;<br>`422`: 422 status code;<br> `423`: 423 status code;<br> `424`: 424 status code;<br> `426`: 426 status code;<br> `451`: 451 status code;<br> `5XX`: All 5xx status codes;<br> `500`: 500 status code;<br> `501`: 501 status code;<br> `502`: 502 status code;<br> `503`: 503 status code;<br> `504`: 504 status code;<br> `505`: 505 status code;<br> `506`: 506 status code;<br> `507`: 507 status code;<br> `510`: 510 status code;<br> `514`: 514 status code;<br> `544`: 544 status code.</li>
	// <li>`tagKey`:<br> Filter by the <strong>tag key</strong><br> Type: String<br> Required: No</li>
	// <li>`tagValue`<br> Filter by the <strong>tag value</strong><br> Type: String<br> Required: No</li>
	Filters []*QueryCondition `json:"Filters,omitnil,omitempty" name:"Filters"`

	// The query time granularity. Values:
	// <li>`min`: 1 minute;</li>
	// <li>`5min`: 5 minutes;</li>
	// <li>`hour`: 1 hour;</li>
	// <li>`day`: 1 day.</li>If this field is not specified, the granularity will be determined based on the interval between the start time and end time as follows: 1-minute granularity applies for a 1-hour interval, 5-minute granularity for a 2-day interval, 1-hour granularity for a 7-day interval, and 1-day granularity for an interval of over 7 days.
	Interval *string `json:"Interval,omitnil,omitempty" name:"Interval"`

	// Geolocation scope. Values:
	// <li>`overseas`: Regions outside the Chinese mainland</li>
	// <li>`mainland`: Chinese mainland</li>
	// <li>`global`: Global</li>If this field is not specified, the default value `global` is used.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`
}

Predefined struct for user

type DescribeTimingL7CacheDataResponse 

type DescribeTimingL7CacheDataResponse struct {
	*tchttp.BaseResponse
	Response *DescribeTimingL7CacheDataResponseParams `json:"Response"`
}

func NewDescribeTimingL7CacheDataResponse 

func NewDescribeTimingL7CacheDataResponse() (response *DescribeTimingL7CacheDataResponse)

func (*DescribeTimingL7CacheDataResponse) FromJsonString 

func (r *DescribeTimingL7CacheDataResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeTimingL7CacheDataResponse) ToJsonString 

func (r *DescribeTimingL7CacheDataResponse) ToJsonString() string

type DescribeTimingL7CacheDataResponseParams 

type DescribeTimingL7CacheDataResponseParams struct {
	// Total number of query results.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// The list of cached L7 time-series data.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Data []*TimingDataRecord `json:"Data,omitnil,omitempty" name:"Data"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeTopL7AnalysisDataRequest 

type DescribeTopL7AnalysisDataRequest struct {
	*tchttp.BaseRequest

	// The start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// The end time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// The metrics queried. Valid values:
	// <li> l7Flow_outFlux_country: statistics of the L7 EdgeOne response traffic by country/region;</li>
	// <li> l7Flow_outFlux_province: statistics of the L7 EdgeOne response traffic by province within the Chinese mainland;</li>
	// <li> l7Flow_outFlux_statusCode: statistics of the L7 EdgeOne response traffic by status code;</li>
	// <li> l7Flow_outFlux_domain: statistics of the L7 EdgeOne response traffic by domain name;</li>
	// <li> l7Flow_outFlux_url: statistics of the L7 EdgeOne response traffic by URL path;</li>
	// <li> l7Flow_outFlux_resourceType: statistics of the L7 EdgeOne response traffic by resource type;</li>
	// <li> l7Flow_outFlux_sip: statistics of the L7 EdgeOne response traffic by client IP;</li>
	// <li> l7Flow_outFlux_referers: statistics of the L7 EdgeOne response traffic by Referer;</li>
	// <li> l7Flow_outFlux_ua_device: statistics of the L7 EdgeOne response traffic by device type;</li>
	// <li> l7Flow_outFlux_ua_browser: statistics of the L7 EdgeOne response traffic by browser type;</li>
	// <li> l7Flow_outFlux_us_os: statistics of the L7 EdgeOne response traffic by operating system type;</li>
	// <li> l7Flow_request_country: statistics of the L7 access request count by country/region;</li>
	// <li> l7Flow_request_province: statistics of the L7 access request count by province within the Chinese mainland;</li>
	// <li> l7Flow_request_statusCode: statistics of the L7 access request count by status code;</li>
	// <li> l7Flow_request_domain: statistics of the L7 access request count by domain name;</li>
	// <li> l7Flow_request_url: statistics of the L7 access request count by URL path;</li>
	// <li> l7Flow_request_resourceType: statistics of the L7 access request count by resource type;</li>
	// <li> l7Flow_request_sip: statistics of the L7 access request count by client IP;</li>
	// <li> l7Flow_request_referer: statistics of the L7 access request count by Referer;</li>
	// <li> l7Flow_request_ua_device: statistics of the L7 access request count by device type;</li>
	// <li> l7Flow_request_ua_browser: statistics of the L7 access request count by browser type;</li>
	// <li> l7Flow_request_us_os: statistics of the L7 access request count by operating system type.</li>
	MetricName *string `json:"MetricName,omitnil,omitempty" name:"MetricName"`

	// ZoneId set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// Indicates the top N data to be queried. The maximum value is 1000. If this parameter is not input, the default value is 10, indicating querying the top 10 data.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter criteria. The detailed Key values are as follows:
	// <li>country: Filter by country/region. The country/region follows the <a href="https://baike.baidu.com/item/ISO%203166-1/5269555">ISO 3166-1 alpha-2</a> standard. Example value: CN.</li>
	// <li>province: Filter by province. This parameter is supported only when the service area is the Chinese mainland. For province codes, refer to the <a href="https://intl.cloud.tencent.com/document/product/228/6316?from_cn_redirect=1#.E5.8C.BA.E5.9F.9F-.2F-.E8.BF.90.E8.90.A5.E5.95.86.E6.98.A0.E5.B0.84.E8.A1.A8">Mapping Table of Provinces Within the Chinese Mainland</a>. Example value: 22.</li>
	// <li>isp: Filter by ISP. This parameter is supported only when the service area is the Chinese mainland. Valid values are as follows:<br> 2: China Telecom;<br> 26: China Unicom;<br> 1046: China Mobile;<br> 3947: China Tietong;<br> 38: CERNET;<br> 43: Great Wall Broadband;<br> 0: other ISPs.</li>
	// <li>domain: Filter by subdomain name. Example value: www.example.com.</li>
	// <li>url: Filter by URL path. Example value: /content or /content/test.jpg. If the url parameter is input, up to 30 days of data can be queried.</li>
	// <li>referer: Filter by Referer request header. Example value: http://www.example.com/. If the referer parameter is input, up to 30 days of data can be queried.</li>
	// <li>resourceType: Filter by resource type, which is generally the file suffix. Example value: .jpg. If the resourceType parameter is input, up to 30 days of data can be queried;</li>
	// <li>protocol: Filter by HTTP protocol version. Valid values are as follows:<br> HTTP/1.0;<br> HTTP/1.1;<br> HTTP/2.0;<br> HTTP/3;<br> WebSocket.</li>
	// <li>socket: Filter by HTTP protocol type. Valid values are as follows:<br> HTTP: HTTP protocol;<br> HTTPS: HTTPS protocol;<br> QUIC: QUIC protocol.</li>
	// <li>statusCode: Filter by edge status code. If the statusCode parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> 1XX: 1xx status code;<br> 2XX: 2xx status code;<br> 3XX: 3xx status code;<br> 4XX: 4xx status code;<br> 5XX: 5xx status code;<br> An integer within the range [0,600).</li>
	// <li>browserType: Filter by browser type. If the browserType parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> Firefox: Firefox browser;<br> Chrome: Chrome browser;<br> Safari: Safari browser;<br> Other: other browser types;<br> Empty: The browser type is empty;<br> Bot: search engine crawler;<br> MicrosoftEdge: Microsoft Edge browser;<br> IE: IE browser;<br> Opera: Opera browser;<br> QQBrowser: QQ browser;<br> LBBrowser: LB browser;<br> MaxthonBrowser: Maxthon browser;<br> SouGouBrowser: Sogou browser;<br> BIDUBrowser: Baidu browser;<br> TaoBrowser: Tao browser;<br> UBrowser: UC browser.</li>
	// <li>deviceType: Filter by device type. If the deviceType parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> TV: TV device;<br> Tablet: tablet device;<br> Mobile: mobile device;<br> Desktop: desktop device;<br> Other: other device types;<br> Empty: The device type is empty.</li>
	// <li>operatingSystemType: Filter by operating system type. If the operatingSystemType parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> Linux: Linux operating system;<br> MacOS: MacOS operating system;<br> Android: Android operating system;<br> IOS: iOS operating system;<br> Windows: Windows operating system;<br> NetBSD: NetBSD;<br> ChromiumOS: ChromiumOS;<br> Bot: search engine crawler;<br> Other: other types of operating systems;<br> Empty: The operating system is empty.</li>
	// <li>tlsVersion: Filter by TLS version. If the tlsVersion parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> TLS1.0;<br> TLS1.1;<br> TLS1.2;<br> TLS1.3.</li>
	// <li>ipVersion: Filter by IP version. Valid values are as follows:<br> 4: IPv4;<br> 6: IPv6.</li>
	// <li>cacheType: Filter by cache status. Valid values are as follows:<br> hit: The request hits the EdgeOne node cache and the resources are provided by the node cache. A partial cache hit for resources is also recorded as hit.<br> miss: The request does not hit the EdgeOne node cache and the resources are provided by the origin server.<br> dynamic: The requested resources cannot be cached or are not configured with node cache and are provided by the origin server.<br> other: unrecognizable cache status. Requests responded to by edge functions are recorded as other.</li>
	// <li>clientIp: Filter by client IP.</li>
	Filters []*QueryCondition `json:"Filters,omitnil,omitempty" name:"Filters"`

	// Query period granularity. Valid values:
	// <li>min: 1 minute;</li>
	// <li>5min: 5 minutes;</li>
	// <li>hour: 1 hour;</li>
	// <li>day: 1 day.</li>If this parameter is not filled in, the granularity will be automatically calculated based on the interval between the start time and end time. Specifically, data will be queried with a granularity of min, 5min, hour, and day respectively when the period is no more than 2 hours, no more than 2 days, no more than 7 days, and over 7 days.
	Interval *string `json:"Interval,omitnil,omitempty" name:"Interval"`

	// Data region. Values:
	// <li>overseas: Regions outside the Chinese mainland</li>
	// <li>mainland: Chinese mainland</li>
	// <li>global: Global</li>If this field is not specified, the default value `global` is used.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`
}

func NewDescribeTopL7AnalysisDataRequest 

func NewDescribeTopL7AnalysisDataRequest() (request *DescribeTopL7AnalysisDataRequest)

func (*DescribeTopL7AnalysisDataRequest) FromJsonString 

func (r *DescribeTopL7AnalysisDataRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeTopL7AnalysisDataRequest) ToJsonString 

func (r *DescribeTopL7AnalysisDataRequest) ToJsonString() string

type DescribeTopL7AnalysisDataRequestParams 

type DescribeTopL7AnalysisDataRequestParams struct {
	// The start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// The end time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// The metrics queried. Valid values:
	// <li> l7Flow_outFlux_country: statistics of the L7 EdgeOne response traffic by country/region;</li>
	// <li> l7Flow_outFlux_province: statistics of the L7 EdgeOne response traffic by province within the Chinese mainland;</li>
	// <li> l7Flow_outFlux_statusCode: statistics of the L7 EdgeOne response traffic by status code;</li>
	// <li> l7Flow_outFlux_domain: statistics of the L7 EdgeOne response traffic by domain name;</li>
	// <li> l7Flow_outFlux_url: statistics of the L7 EdgeOne response traffic by URL path;</li>
	// <li> l7Flow_outFlux_resourceType: statistics of the L7 EdgeOne response traffic by resource type;</li>
	// <li> l7Flow_outFlux_sip: statistics of the L7 EdgeOne response traffic by client IP;</li>
	// <li> l7Flow_outFlux_referers: statistics of the L7 EdgeOne response traffic by Referer;</li>
	// <li> l7Flow_outFlux_ua_device: statistics of the L7 EdgeOne response traffic by device type;</li>
	// <li> l7Flow_outFlux_ua_browser: statistics of the L7 EdgeOne response traffic by browser type;</li>
	// <li> l7Flow_outFlux_us_os: statistics of the L7 EdgeOne response traffic by operating system type;</li>
	// <li> l7Flow_request_country: statistics of the L7 access request count by country/region;</li>
	// <li> l7Flow_request_province: statistics of the L7 access request count by province within the Chinese mainland;</li>
	// <li> l7Flow_request_statusCode: statistics of the L7 access request count by status code;</li>
	// <li> l7Flow_request_domain: statistics of the L7 access request count by domain name;</li>
	// <li> l7Flow_request_url: statistics of the L7 access request count by URL path;</li>
	// <li> l7Flow_request_resourceType: statistics of the L7 access request count by resource type;</li>
	// <li> l7Flow_request_sip: statistics of the L7 access request count by client IP;</li>
	// <li> l7Flow_request_referer: statistics of the L7 access request count by Referer;</li>
	// <li> l7Flow_request_ua_device: statistics of the L7 access request count by device type;</li>
	// <li> l7Flow_request_ua_browser: statistics of the L7 access request count by browser type;</li>
	// <li> l7Flow_request_us_os: statistics of the L7 access request count by operating system type.</li>
	MetricName *string `json:"MetricName,omitnil,omitempty" name:"MetricName"`

	// ZoneId set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// Indicates the top N data to be queried. The maximum value is 1000. If this parameter is not input, the default value is 10, indicating querying the top 10 data.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter criteria. The detailed Key values are as follows:
	// <li>country: Filter by country/region. The country/region follows the <a href="https://baike.baidu.com/item/ISO%203166-1/5269555">ISO 3166-1 alpha-2</a> standard. Example value: CN.</li>
	// <li>province: Filter by province. This parameter is supported only when the service area is the Chinese mainland. For province codes, refer to the <a href="https://intl.cloud.tencent.com/document/product/228/6316?from_cn_redirect=1#.E5.8C.BA.E5.9F.9F-.2F-.E8.BF.90.E8.90.A5.E5.95.86.E6.98.A0.E5.B0.84.E8.A1.A8">Mapping Table of Provinces Within the Chinese Mainland</a>. Example value: 22.</li>
	// <li>isp: Filter by ISP. This parameter is supported only when the service area is the Chinese mainland. Valid values are as follows:<br> 2: China Telecom;<br> 26: China Unicom;<br> 1046: China Mobile;<br> 3947: China Tietong;<br> 38: CERNET;<br> 43: Great Wall Broadband;<br> 0: other ISPs.</li>
	// <li>domain: Filter by subdomain name. Example value: www.example.com.</li>
	// <li>url: Filter by URL path. Example value: /content or /content/test.jpg. If the url parameter is input, up to 30 days of data can be queried.</li>
	// <li>referer: Filter by Referer request header. Example value: http://www.example.com/. If the referer parameter is input, up to 30 days of data can be queried.</li>
	// <li>resourceType: Filter by resource type, which is generally the file suffix. Example value: .jpg. If the resourceType parameter is input, up to 30 days of data can be queried;</li>
	// <li>protocol: Filter by HTTP protocol version. Valid values are as follows:<br> HTTP/1.0;<br> HTTP/1.1;<br> HTTP/2.0;<br> HTTP/3;<br> WebSocket.</li>
	// <li>socket: Filter by HTTP protocol type. Valid values are as follows:<br> HTTP: HTTP protocol;<br> HTTPS: HTTPS protocol;<br> QUIC: QUIC protocol.</li>
	// <li>statusCode: Filter by edge status code. If the statusCode parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> 1XX: 1xx status code;<br> 2XX: 2xx status code;<br> 3XX: 3xx status code;<br> 4XX: 4xx status code;<br> 5XX: 5xx status code;<br> An integer within the range [0,600).</li>
	// <li>browserType: Filter by browser type. If the browserType parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> Firefox: Firefox browser;<br> Chrome: Chrome browser;<br> Safari: Safari browser;<br> Other: other browser types;<br> Empty: The browser type is empty;<br> Bot: search engine crawler;<br> MicrosoftEdge: Microsoft Edge browser;<br> IE: IE browser;<br> Opera: Opera browser;<br> QQBrowser: QQ browser;<br> LBBrowser: LB browser;<br> MaxthonBrowser: Maxthon browser;<br> SouGouBrowser: Sogou browser;<br> BIDUBrowser: Baidu browser;<br> TaoBrowser: Tao browser;<br> UBrowser: UC browser.</li>
	// <li>deviceType: Filter by device type. If the deviceType parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> TV: TV device;<br> Tablet: tablet device;<br> Mobile: mobile device;<br> Desktop: desktop device;<br> Other: other device types;<br> Empty: The device type is empty.</li>
	// <li>operatingSystemType: Filter by operating system type. If the operatingSystemType parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> Linux: Linux operating system;<br> MacOS: MacOS operating system;<br> Android: Android operating system;<br> IOS: iOS operating system;<br> Windows: Windows operating system;<br> NetBSD: NetBSD;<br> ChromiumOS: ChromiumOS;<br> Bot: search engine crawler;<br> Other: other types of operating systems;<br> Empty: The operating system is empty.</li>
	// <li>tlsVersion: Filter by TLS version. If the tlsVersion parameter is input, up to 30 days of data can be queried. Valid values are as follows:<br> TLS1.0;<br> TLS1.1;<br> TLS1.2;<br> TLS1.3.</li>
	// <li>ipVersion: Filter by IP version. Valid values are as follows:<br> 4: IPv4;<br> 6: IPv6.</li>
	// <li>cacheType: Filter by cache status. Valid values are as follows:<br> hit: The request hits the EdgeOne node cache and the resources are provided by the node cache. A partial cache hit for resources is also recorded as hit.<br> miss: The request does not hit the EdgeOne node cache and the resources are provided by the origin server.<br> dynamic: The requested resources cannot be cached or are not configured with node cache and are provided by the origin server.<br> other: unrecognizable cache status. Requests responded to by edge functions are recorded as other.</li>
	// <li>clientIp: Filter by client IP.</li>
	Filters []*QueryCondition `json:"Filters,omitnil,omitempty" name:"Filters"`

	// Query period granularity. Valid values:
	// <li>min: 1 minute;</li>
	// <li>5min: 5 minutes;</li>
	// <li>hour: 1 hour;</li>
	// <li>day: 1 day.</li>If this parameter is not filled in, the granularity will be automatically calculated based on the interval between the start time and end time. Specifically, data will be queried with a granularity of min, 5min, hour, and day respectively when the period is no more than 2 hours, no more than 2 days, no more than 7 days, and over 7 days.
	Interval *string `json:"Interval,omitnil,omitempty" name:"Interval"`

	// Data region. Values:
	// <li>overseas: Regions outside the Chinese mainland</li>
	// <li>mainland: Chinese mainland</li>
	// <li>global: Global</li>If this field is not specified, the default value `global` is used.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`
}

Predefined struct for user

type DescribeTopL7AnalysisDataResponse 

type DescribeTopL7AnalysisDataResponse struct {
	*tchttp.BaseResponse
	Response *DescribeTopL7AnalysisDataResponseParams `json:"Response"`
}

func NewDescribeTopL7AnalysisDataResponse 

func NewDescribeTopL7AnalysisDataResponse() (response *DescribeTopL7AnalysisDataResponse)

func (*DescribeTopL7AnalysisDataResponse) FromJsonString 

func (r *DescribeTopL7AnalysisDataResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeTopL7AnalysisDataResponse) ToJsonString 

func (r *DescribeTopL7AnalysisDataResponse) ToJsonString() string

type DescribeTopL7AnalysisDataResponseParams 

type DescribeTopL7AnalysisDataResponseParams struct {
	// Total number of query results.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// The top N data list obtained from the statistics of L7 access data by a specified dimension MetricName.
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	Data []*TopDataRecord `json:"Data,omitnil,omitempty" name:"Data"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeTopL7CacheDataRequest 

type DescribeTopL7CacheDataRequest struct {
	*tchttp.BaseRequest

	// The start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// The end time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// The query metric. Values:
	// <li>l7Cache_outFlux_domain: Host/Domain name;</li>
	// <li>l7Cache_outFlux_url: URL address;</li>
	// <li>l7Cache_outFlux_resourceType: Resource type;</li>
	// <li>l7Cache_outFlux_statusCode: Status code.</li>
	MetricName *string `json:"MetricName,omitnil,omitempty" name:"MetricName"`

	// ZoneId set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// The number of data entries to be queried. The maximum value is 1000. If it is not specified, the value 10 is used by default, indicating that the top 10 data entries.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter conditions. See below for details:
	// <li>`domain`<br> Filter by the <strong>sub-domain name</strong>, such as `test.example.com`<br> Type: String<br> Required: No</li>
	// <li>`url`<br> Filter by the <strong>URL</strong>, such as `/content`. The query period cannot exceed 30 days. <br> Type: String<br> Required: No</li>
	// <li>`resourceType`<br> Filter by the <strong>resource file type</strong>, such as `jpg`, `png`. The query period cannot exceed 30 days.<br>Type: String<br> Required: No</li>
	// <li>cacheType<br>Filter by the <strong>cache hit result</strong>.<br>Type: String<br> Required: No<br> Values: <br> `hit`: Cache hit; <br> `dynamic`: Resource non-cacheable; <br> `miss`: Cache miss</li>
	// <li>`statusCode`<br> Filter by the <strong> status code</strong>. The query period  cannot exceed 30 days. <br> Type: String<br> Required: No<br> Values: <br> `1XX`: All 1xx status codes;<br> `100`: 100 status code;<br> `101`: 101 status code;<br> `102`: 102 status code;<br> `2XX`: All 2xx status codes;<br> `200`: 200 status code;<br> `201`: 201 status code;<br> `202`: 202 status code;<br> `203`: 203 status code;<br> `204`: 204 status code;<br> `205`: 205 status code;<br> `206`: 206 status code;<br> `207`: 207 status code;<br> `3XX`: All 3xx status codes;<br> `300`: 300 status code;<br> `301`: 301 status code;<br> `302`: 302 status code;<br> `303`: 303 status code;<br> `304`: 304 status code;<br> `305`: 305 status code;<br> `307`: 307 status code;<br> `4XX`: All 4xx status codes;<br> `400`: 400 status code;<br> `401`: 401 status code;<br> `402`: 402 status code;<br> `403`: 403 status code;<br> `404`: 404 status code;<br> `405`: 405 status code;<br> `406`: 406 status code;<br> `407`: 407 status code;<br> `408`: 408 status code;<br> `409`: 409 status code;<br> `410`: 410 status code;<br> `411`: 411 status code;<br> `412`: 412 status code;<br> `412`: 413 status code;<br> `414`: 414 status code;<br> `415`: 415 status code;<br> `416`: 416 status code;<br> `417`: 417 status code;<br>`422`: 422 status code;<br> `423`: 423 status code;<br> `424`: 424 status code;<br> `426`: 426 status code;<br> `451`: 451 status code;<br> `5XX`: All 5xx status codes;<br> `500`: 500 status code;<br> `501`: 501 status code;<br> `502`: 502 status code;<br> `503`: 503 status code;<br> `504`: 504 status code;<br> `505`: 505 status code;<br> `506`: 506 status code;<br> `507`: 507 status code;<br> `510`: 510 status code;<br> `514`: 514 status code;<br> `544`: 544 status code.</li>
	// <li>`tagKey`:<br> Filter by the <strong>tag key</strong><br> Type: String<br> Required: No</li>
	// <li>`tagValue`<br> Filter by the <strong>tag value</strong><br> Type: String<br> Required: No</li>
	Filters []*QueryCondition `json:"Filters,omitnil,omitempty" name:"Filters"`

	// The query time granularity. Values:
	// <li>`min`: 1 minute;</li>
	// <li>`5min`: 5 minutes;</li>
	// <li>`hour`: 1 hour;</li>
	// <li>`day`: 1 day.</li>If this field is not specified, the granularity will be determined based on the interval between the start time and end time as follows: 1-minute granularity applies for a 1-hour interval, 5-minute granularity for a 2-day interval, 1-hour granularity for a 7-day interval, and 1-day granularity for an interval of over 7 days.
	Interval *string `json:"Interval,omitnil,omitempty" name:"Interval"`

	// Geolocation scope. Values:
	// <li>`overseas`: Regions outside the Chinese mainland</li>
	// <li>`mainland`: Chinese mainland</li>
	// <li>`global`: Global</li>If this field is not specified, the default value `global` is used.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`
}

func NewDescribeTopL7CacheDataRequest 

func NewDescribeTopL7CacheDataRequest() (request *DescribeTopL7CacheDataRequest)

func (*DescribeTopL7CacheDataRequest) FromJsonString 

func (r *DescribeTopL7CacheDataRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeTopL7CacheDataRequest) ToJsonString 

func (r *DescribeTopL7CacheDataRequest) ToJsonString() string

type DescribeTopL7CacheDataRequestParams 

type DescribeTopL7CacheDataRequestParams struct {
	// The start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// The end time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// The query metric. Values:
	// <li>l7Cache_outFlux_domain: Host/Domain name;</li>
	// <li>l7Cache_outFlux_url: URL address;</li>
	// <li>l7Cache_outFlux_resourceType: Resource type;</li>
	// <li>l7Cache_outFlux_statusCode: Status code.</li>
	MetricName *string `json:"MetricName,omitnil,omitempty" name:"MetricName"`

	// ZoneId set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// The number of data entries to be queried. The maximum value is 1000. If it is not specified, the value 10 is used by default, indicating that the top 10 data entries.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter conditions. See below for details:
	// <li>`domain`<br> Filter by the <strong>sub-domain name</strong>, such as `test.example.com`<br> Type: String<br> Required: No</li>
	// <li>`url`<br> Filter by the <strong>URL</strong>, such as `/content`. The query period cannot exceed 30 days. <br> Type: String<br> Required: No</li>
	// <li>`resourceType`<br> Filter by the <strong>resource file type</strong>, such as `jpg`, `png`. The query period cannot exceed 30 days.<br>Type: String<br> Required: No</li>
	// <li>cacheType<br>Filter by the <strong>cache hit result</strong>.<br>Type: String<br> Required: No<br> Values: <br> `hit`: Cache hit; <br> `dynamic`: Resource non-cacheable; <br> `miss`: Cache miss</li>
	// <li>`statusCode`<br> Filter by the <strong> status code</strong>. The query period  cannot exceed 30 days. <br> Type: String<br> Required: No<br> Values: <br> `1XX`: All 1xx status codes;<br> `100`: 100 status code;<br> `101`: 101 status code;<br> `102`: 102 status code;<br> `2XX`: All 2xx status codes;<br> `200`: 200 status code;<br> `201`: 201 status code;<br> `202`: 202 status code;<br> `203`: 203 status code;<br> `204`: 204 status code;<br> `205`: 205 status code;<br> `206`: 206 status code;<br> `207`: 207 status code;<br> `3XX`: All 3xx status codes;<br> `300`: 300 status code;<br> `301`: 301 status code;<br> `302`: 302 status code;<br> `303`: 303 status code;<br> `304`: 304 status code;<br> `305`: 305 status code;<br> `307`: 307 status code;<br> `4XX`: All 4xx status codes;<br> `400`: 400 status code;<br> `401`: 401 status code;<br> `402`: 402 status code;<br> `403`: 403 status code;<br> `404`: 404 status code;<br> `405`: 405 status code;<br> `406`: 406 status code;<br> `407`: 407 status code;<br> `408`: 408 status code;<br> `409`: 409 status code;<br> `410`: 410 status code;<br> `411`: 411 status code;<br> `412`: 412 status code;<br> `412`: 413 status code;<br> `414`: 414 status code;<br> `415`: 415 status code;<br> `416`: 416 status code;<br> `417`: 417 status code;<br>`422`: 422 status code;<br> `423`: 423 status code;<br> `424`: 424 status code;<br> `426`: 426 status code;<br> `451`: 451 status code;<br> `5XX`: All 5xx status codes;<br> `500`: 500 status code;<br> `501`: 501 status code;<br> `502`: 502 status code;<br> `503`: 503 status code;<br> `504`: 504 status code;<br> `505`: 505 status code;<br> `506`: 506 status code;<br> `507`: 507 status code;<br> `510`: 510 status code;<br> `514`: 514 status code;<br> `544`: 544 status code.</li>
	// <li>`tagKey`:<br> Filter by the <strong>tag key</strong><br> Type: String<br> Required: No</li>
	// <li>`tagValue`<br> Filter by the <strong>tag value</strong><br> Type: String<br> Required: No</li>
	Filters []*QueryCondition `json:"Filters,omitnil,omitempty" name:"Filters"`

	// The query time granularity. Values:
	// <li>`min`: 1 minute;</li>
	// <li>`5min`: 5 minutes;</li>
	// <li>`hour`: 1 hour;</li>
	// <li>`day`: 1 day.</li>If this field is not specified, the granularity will be determined based on the interval between the start time and end time as follows: 1-minute granularity applies for a 1-hour interval, 5-minute granularity for a 2-day interval, 1-hour granularity for a 7-day interval, and 1-day granularity for an interval of over 7 days.
	Interval *string `json:"Interval,omitnil,omitempty" name:"Interval"`

	// Geolocation scope. Values:
	// <li>`overseas`: Regions outside the Chinese mainland</li>
	// <li>`mainland`: Chinese mainland</li>
	// <li>`global`: Global</li>If this field is not specified, the default value `global` is used.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`
}

Predefined struct for user

type DescribeTopL7CacheDataResponse 

type DescribeTopL7CacheDataResponse struct {
	*tchttp.BaseResponse
	Response *DescribeTopL7CacheDataResponseParams `json:"Response"`
}

func NewDescribeTopL7CacheDataResponse 

func NewDescribeTopL7CacheDataResponse() (response *DescribeTopL7CacheDataResponse)

func (*DescribeTopL7CacheDataResponse) FromJsonString 

func (r *DescribeTopL7CacheDataResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeTopL7CacheDataResponse) ToJsonString 

func (r *DescribeTopL7CacheDataResponse) ToJsonString() string

type DescribeTopL7CacheDataResponseParams 

type DescribeTopL7CacheDataResponseParams struct {
	// Total number of query results.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// The list of cached L7 top-ranked traffic data.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Data []*TopDataRecord `json:"Data,omitnil,omitempty" name:"Data"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeZoneSettingRequest 

type DescribeZoneSettingRequest struct {
	*tchttp.BaseRequest

	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`
}

func NewDescribeZoneSettingRequest 

func NewDescribeZoneSettingRequest() (request *DescribeZoneSettingRequest)

func (*DescribeZoneSettingRequest) FromJsonString 

func (r *DescribeZoneSettingRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeZoneSettingRequest) ToJsonString 

func (r *DescribeZoneSettingRequest) ToJsonString() string

type DescribeZoneSettingRequestParams 

type DescribeZoneSettingRequestParams struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`
}

Predefined struct for user

type DescribeZoneSettingResponse 

type DescribeZoneSettingResponse struct {
	*tchttp.BaseResponse
	Response *DescribeZoneSettingResponseParams `json:"Response"`
}

func NewDescribeZoneSettingResponse 

func NewDescribeZoneSettingResponse() (response *DescribeZoneSettingResponse)

func (*DescribeZoneSettingResponse) FromJsonString 

func (r *DescribeZoneSettingResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeZoneSettingResponse) ToJsonString 

func (r *DescribeZoneSettingResponse) ToJsonString() string

type DescribeZoneSettingResponseParams 

type DescribeZoneSettingResponseParams struct {
	// The site configuration.
	// Note: This field may return null, indicating that no valid values can be obtained.
	ZoneSetting *ZoneSetting `json:"ZoneSetting,omitnil,omitempty" name:"ZoneSetting"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DescribeZonesRequest 

type DescribeZonesRequest struct {
	*tchttp.BaseRequest

	// The page offset. Default value: 0
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Limit on paginated queries. Default value: 20. Maximum value: 100.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter conditions. Up to 20 values for each filter. If this parameter is not filled in, the information of all sites under the current account is returned. Detailed filtering conditions are as follows:
	// <li>`zone-name`: Site name </li><li>`zone-id`: Site ID, such as zone-2noz78a8ev6k</li><li>`status`: Site status </li><li>`tag-key`: Tag key </li><li>`tag-value`: Tag value </li>Only `zone-name` supports fuzzy query.
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`

	// Sort the returned results according to this field. Values include:
	// <li>`type`: Connection mode</li>
	// <li>`area`: Acceleration region</li>
	// <li>`create-time`: Creation time</li>
	// <li>`zone-name`: Site name</li>
	// <li>`use-time`: Last used time</li>
	// <li>`active-status` Effective status</li> Default value: `create-time`
	Order *string `json:"Order,omitnil,omitempty" name:"Order"`

	// Sort direction. If the field value is a number, sort by the numeric value. If the field value is text, sort by the ascill code. Values include:
	// <li>`asc`: From the smallest to largest</li>
	// <li>`desc`: From the largest to smallest.</li>Default value: `desc`
	Direction *string `json:"Direction,omitnil,omitempty" name:"Direction"`
}

func NewDescribeZonesRequest 

func NewDescribeZonesRequest() (request *DescribeZonesRequest)

func (*DescribeZonesRequest) FromJsonString 

func (r *DescribeZonesRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeZonesRequest) ToJsonString 

func (r *DescribeZonesRequest) ToJsonString() string

type DescribeZonesRequestParams 

type DescribeZonesRequestParams struct {
	// The page offset. Default value: 0
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`

	// Limit on paginated queries. Default value: 20. Maximum value: 100.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// Filter conditions. Up to 20 values for each filter. If this parameter is not filled in, the information of all sites under the current account is returned. Detailed filtering conditions are as follows:
	// <li>`zone-name`: Site name </li><li>`zone-id`: Site ID, such as zone-2noz78a8ev6k</li><li>`status`: Site status </li><li>`tag-key`: Tag key </li><li>`tag-value`: Tag value </li>Only `zone-name` supports fuzzy query.
	Filters []*AdvancedFilter `json:"Filters,omitnil,omitempty" name:"Filters"`

	// Sort the returned results according to this field. Values include:
	// <li>`type`: Connection mode</li>
	// <li>`area`: Acceleration region</li>
	// <li>`create-time`: Creation time</li>
	// <li>`zone-name`: Site name</li>
	// <li>`use-time`: Last used time</li>
	// <li>`active-status` Effective status</li> Default value: `create-time`
	Order *string `json:"Order,omitnil,omitempty" name:"Order"`

	// Sort direction. If the field value is a number, sort by the numeric value. If the field value is text, sort by the ascill code. Values include:
	// <li>`asc`: From the smallest to largest</li>
	// <li>`desc`: From the largest to smallest.</li>Default value: `desc`
	Direction *string `json:"Direction,omitnil,omitempty" name:"Direction"`
}

Predefined struct for user

type DescribeZonesResponse 

type DescribeZonesResponse struct {
	*tchttp.BaseResponse
	Response *DescribeZonesResponseParams `json:"Response"`
}

func NewDescribeZonesResponse 

func NewDescribeZonesResponse() (response *DescribeZonesResponse)

func (*DescribeZonesResponse) FromJsonString 

func (r *DescribeZonesResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DescribeZonesResponse) ToJsonString 

func (r *DescribeZonesResponse) ToJsonString() string

type DescribeZonesResponseParams 

type DescribeZonesResponseParams struct {
	// Number of eligible sites.
	TotalCount *int64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// Details of sites.
	Zones []*Zone `json:"Zones,omitnil,omitempty" name:"Zones"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DestroyPlanRequest 

type DestroyPlanRequest struct {
	*tchttp.BaseRequest

	// Plan ID, in the format of edgeone-2wdo315m2y4c.
	PlanId *string `json:"PlanId,omitnil,omitempty" name:"PlanId"`
}

func NewDestroyPlanRequest 

func NewDestroyPlanRequest() (request *DestroyPlanRequest)

func (*DestroyPlanRequest) FromJsonString 

func (r *DestroyPlanRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DestroyPlanRequest) ToJsonString 

func (r *DestroyPlanRequest) ToJsonString() string

type DestroyPlanRequestParams 

type DestroyPlanRequestParams struct {
	// Plan ID, in the format of edgeone-2wdo315m2y4c.
	PlanId *string `json:"PlanId,omitnil,omitempty" name:"PlanId"`
}

Predefined struct for user

type DestroyPlanResponse 

type DestroyPlanResponse struct {
	*tchttp.BaseResponse
	Response *DestroyPlanResponseParams `json:"Response"`
}

func NewDestroyPlanResponse 

func NewDestroyPlanResponse() (response *DestroyPlanResponse)

func (*DestroyPlanResponse) FromJsonString 

func (r *DestroyPlanResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DestroyPlanResponse) ToJsonString 

func (r *DestroyPlanResponse) ToJsonString() string

type DestroyPlanResponseParams 

type DestroyPlanResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DetailHost 

type DetailHost struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The acceleration status. Values:
	// <li>`process`: In progress</li>
	// <li>`online`: Enabled</li>
	// <li>`offline`: Disabled</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// The domain name.
	Host *string `json:"Host,omitnil,omitempty" name:"Host"`

	// Name of the site
	ZoneName *string `json:"ZoneName,omitnil,omitempty" name:"ZoneName"`

	// The assigned CNAME
	Cname *string `json:"Cname,omitnil,omitempty" name:"Cname"`

	// The resource ID.
	Id *string `json:"Id,omitnil,omitempty" name:"Id"`

	// The instance ID.
	InstanceId *string `json:"InstanceId,omitnil,omitempty" name:"InstanceId"`

	// The lock status.
	Lock *int64 `json:"Lock,omitnil,omitempty" name:"Lock"`

	// The domain name status.
	Mode *int64 `json:"Mode,omitnil,omitempty" name:"Mode"`

	// The acceleration area of the domain name. Values:
	// <li>`global`: Global.</li>
	// <li>`mainland`: Chinese mainland.</li>
	// <li>`overseas`: Outside the Chinese mainland.</li>
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// The acceleration type configuration item.
	// Note: This field may return null, indicating that no valid values can be obtained.
	AccelerateType *AccelerateType `json:"AccelerateType,omitnil,omitempty" name:"AccelerateType"`

	// The HTTPS configuration item.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Https *Https `json:"Https,omitnil,omitempty" name:"Https"`

	// The cache configuration item.
	// Note: This field may return null, indicating that no valid values can be obtained.
	CacheConfig *CacheConfig `json:"CacheConfig,omitnil,omitempty" name:"CacheConfig"`

	// The origin configuration item.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Origin *Origin `json:"Origin,omitnil,omitempty" name:"Origin"`

	// The security type.
	// Note: This field may return null, indicating that no valid values can be obtained.
	SecurityType *SecurityType `json:"SecurityType,omitnil,omitempty" name:"SecurityType"`

	// The cache key configuration item.
	// Note: This field may return null, indicating that no valid values can be obtained.
	CacheKey *CacheKey `json:"CacheKey,omitnil,omitempty" name:"CacheKey"`

	// The smart compression configuration item.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Compression *Compression `json:"Compression,omitnil,omitempty" name:"Compression"`

	// The WAF protection configuration item.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Waf *Waf `json:"Waf,omitnil,omitempty" name:"Waf"`

	// The CC protection configuration item.
	// Note: This field may return null, indicating that no valid values can be obtained.
	CC *CC `json:"CC,omitnil,omitempty" name:"CC"`

	// DDoS mitigation configuration
	// Note: This field may return null, indicating that no valid values can be obtained.
	DDoS *DDoS `json:"DDoS,omitnil,omitempty" name:"DDoS"`

	// The smart routing configuration item.
	// Note: This field may return null, indicating that no valid values can be obtained.
	SmartRouting *SmartRouting `json:"SmartRouting,omitnil,omitempty" name:"SmartRouting"`

	// The IPv6 access configuration item.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Ipv6 *Ipv6 `json:"Ipv6,omitnil,omitempty" name:"Ipv6"`

	// Whether to carry the location information of the client IP during origin-pull.
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	ClientIpCountry *ClientIpCountry `json:"ClientIpCountry,omitnil,omitempty" name:"ClientIpCountry"`
}

type DiffIPWhitelist 

type DiffIPWhitelist struct {
	// The latest intermediate IPs.
	LatestIPWhitelist *IPWhitelist `json:"LatestIPWhitelist,omitnil,omitempty" name:"LatestIPWhitelist"`

	// The intermediate IPs added to the existing list.
	AddedIPWhitelist *IPWhitelist `json:"AddedIPWhitelist,omitnil,omitempty" name:"AddedIPWhitelist"`

	// The intermediate IPs removed from the existing list.
	RemovedIPWhitelist *IPWhitelist `json:"RemovedIPWhitelist,omitnil,omitempty" name:"RemovedIPWhitelist"`

	// The intermediate IPs that remain unchanged.
	NoChangeIPWhitelist *IPWhitelist `json:"NoChangeIPWhitelist,omitnil,omitempty" name:"NoChangeIPWhitelist"`
}

type DnsVerification 

type DnsVerification struct {
	// The host record.
	Subdomain *string `json:"Subdomain,omitnil,omitempty" name:"Subdomain"`

	// The record type.
	RecordType *string `json:"RecordType,omitnil,omitempty" name:"RecordType"`

	// The record value.
	RecordValue *string `json:"RecordValue,omitnil,omitempty" name:"RecordValue"`
}

type DownloadL4LogsRequest 

type DownloadL4LogsRequest struct {
	*tchttp.BaseRequest

	// The start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// The end time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// ZoneId set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// List of L4 proxy instance IDs.
	ProxyIds []*string `json:"ProxyIds,omitnil,omitempty" name:"ProxyIds"`

	// Limit on paginated queries. Default value: 20. Maximum value: 300.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// The page offset. Default value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`
}

func NewDownloadL4LogsRequest 

func NewDownloadL4LogsRequest() (request *DownloadL4LogsRequest)

func (*DownloadL4LogsRequest) FromJsonString 

func (r *DownloadL4LogsRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DownloadL4LogsRequest) ToJsonString 

func (r *DownloadL4LogsRequest) ToJsonString() string

type DownloadL4LogsRequestParams 

type DownloadL4LogsRequestParams struct {
	// The start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// The end time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// ZoneId set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// List of L4 proxy instance IDs.
	ProxyIds []*string `json:"ProxyIds,omitnil,omitempty" name:"ProxyIds"`

	// Limit on paginated queries. Default value: 20. Maximum value: 300.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// The page offset. Default value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`
}

Predefined struct for user

type DownloadL4LogsResponse 

type DownloadL4LogsResponse struct {
	*tchttp.BaseResponse
	Response *DownloadL4LogsResponseParams `json:"Response"`
}

func NewDownloadL4LogsResponse 

func NewDownloadL4LogsResponse() (response *DownloadL4LogsResponse)

func (*DownloadL4LogsResponse) FromJsonString 

func (r *DownloadL4LogsResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DownloadL4LogsResponse) ToJsonString 

func (r *DownloadL4LogsResponse) ToJsonString() string

type DownloadL4LogsResponseParams 

type DownloadL4LogsResponseParams struct {
	// Total number of query results.
	TotalCount *uint64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// List of L4 logs.
	Data []*L4OfflineLog `json:"Data,omitnil,omitempty" name:"Data"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DownloadL7LogsRequest 

type DownloadL7LogsRequest struct {
	*tchttp.BaseRequest

	// The start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// The end time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// ZoneId set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// List of subdomain names to be queried. All subdomain names will be selected if this field is not specified.
	Domains []*string `json:"Domains,omitnil,omitempty" name:"Domains"`

	// Limit on paginated queries. Default value: 20. Maximum value: 300.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// The page offset. Default value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`
}

func NewDownloadL7LogsRequest 

func NewDownloadL7LogsRequest() (request *DownloadL7LogsRequest)

func (*DownloadL7LogsRequest) FromJsonString 

func (r *DownloadL7LogsRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DownloadL7LogsRequest) ToJsonString 

func (r *DownloadL7LogsRequest) ToJsonString() string

type DownloadL7LogsRequestParams 

type DownloadL7LogsRequestParams struct {
	// The start time.
	StartTime *string `json:"StartTime,omitnil,omitempty" name:"StartTime"`

	// The end time.
	EndTime *string `json:"EndTime,omitnil,omitempty" name:"EndTime"`

	// ZoneId set. This parameter is required.
	ZoneIds []*string `json:"ZoneIds,omitnil,omitempty" name:"ZoneIds"`

	// List of subdomain names to be queried. All subdomain names will be selected if this field is not specified.
	Domains []*string `json:"Domains,omitnil,omitempty" name:"Domains"`

	// Limit on paginated queries. Default value: 20. Maximum value: 300.
	Limit *int64 `json:"Limit,omitnil,omitempty" name:"Limit"`

	// The page offset. Default value: 0.
	Offset *int64 `json:"Offset,omitnil,omitempty" name:"Offset"`
}

Predefined struct for user

type DownloadL7LogsResponse 

type DownloadL7LogsResponse struct {
	*tchttp.BaseResponse
	Response *DownloadL7LogsResponseParams `json:"Response"`
}

func NewDownloadL7LogsResponse 

func NewDownloadL7LogsResponse() (response *DownloadL7LogsResponse)

func (*DownloadL7LogsResponse) FromJsonString 

func (r *DownloadL7LogsResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*DownloadL7LogsResponse) ToJsonString 

func (r *DownloadL7LogsResponse) ToJsonString() string

type DownloadL7LogsResponseParams 

type DownloadL7LogsResponseParams struct {
	// Total number of query results.
	TotalCount *int64 `json:"TotalCount,omitnil,omitempty" name:"TotalCount"`

	// List of L7 logs.
	Data []*L7OfflineLog `json:"Data,omitnil,omitempty" name:"Data"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type DropPageConfig 

type DropPageConfig struct {
	// Whether to enable configuration. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// The settings of the block page that applies managed rules. If it is null, the settings that were last configured will be used.
	// Note: This field may return null, indicating that no valid values can be obtained.
	WafDropPageDetail *DropPageDetail `json:"WafDropPageDetail,omitnil,omitempty" name:"WafDropPageDetail"`

	// The settings of the block page that applies custom rules. If it is null, the settings that were last configured will be used.
	// Note: This field may return null, indicating that no valid values can be obtained.
	AclDropPageDetail *DropPageDetail `json:"AclDropPageDetail,omitnil,omitempty" name:"AclDropPageDetail"`
}

type DropPageDetail 

type DropPageDetail struct {
	// The ID of the block page. Specify `0` to use the default block page.
	// (Disused) If 0 is passed, the default block page will be used.
	PageId *int64 `json:"PageId,omitnil,omitempty" name:"PageId"`

	// The HTTP status code to trigger the block page. Range: 100-600, excluding 3xx codes. Code 566: Requests blocked by managed rules. Code 567: Requests blocked by web security rules (except managed rules).
	StatusCode *int64 `json:"StatusCode,omitnil,omitempty" name:"StatusCode"`

	// The block page file or URL.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// Type of the block page. Values:
	// <li>`page`: Return the specified page.</li>
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// ID of custom response. The ID can be obtained via the `DescribeCustomErrorPages` API. It's required when `Type=page`.
	CustomResponseId *string `json:"CustomResponseId,omitnil,omitempty" name:"CustomResponseId"`
}

type EntityStatus 

type EntityStatus struct {
	// Instance name. Only subdomain names are supported.
	Entity *string `json:"Entity,omitnil,omitempty" name:"Entity"`

	// Instance configuration status. Values:
	// <li>`online`: Configuration has taken effect;</li><li>`fail`: Configuration failed;</li><li>`process`: Configuration is being delivered. </li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// Message returned after the operation completed.
	Message *string `json:"Message,omitnil,omitempty" name:"Message"`
}

type EnvInfo 

type EnvInfo struct {
	// Environment ID.
	EnvId *string `json:"EnvId,omitnil,omitempty" name:"EnvId"`

	// Environment type. Valid values:
	// <li>production: Production environment.</li><li> staging: Test environment. </li>
	EnvType *string `json:"EnvType,omitnil,omitempty" name:"EnvType"`

	// Environment status. Valid values:
	// <li>creating: Being created.</li>
	// <li>running: The environment is stable, with version changes allowed.</li>
	// <li>version_deploying: The version is currently being deployed, with no more changes allowed. </li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// Effective scope of the configuration in the current environment. Valid values:
	// <li>ALL: It takes effect on the entire network when EnvType is set to production.</li>
	// <li>It returns the IP address of the test node for host binding during testing when EnvType is set to staging. </li>
	Scope []*string `json:"Scope,omitnil,omitempty" name:"Scope"`

	// For the effective versions of each configuration group in the current environment, there are two possible scenarios based on the value of Status:
	// <li>When Status is set to version_deploying, the returned value of this field represents the previously effective version. In other words, during the deployment of the new version, the effective version is the one that was in effect before any changes were made.</li>
	// <li>When Status is set to running, the value returned by this field is the currently effective version. </li>
	CurrentConfigGroupVersionInfos []*ConfigGroupVersionInfo `json:"CurrentConfigGroupVersionInfos,omitnil,omitempty" name:"CurrentConfigGroupVersionInfos"`

	// Creation time. The time format follows the ISO 8601 standard and is represented in Coordinated Universal Time (UTC).
	CreateTime *string `json:"CreateTime,omitnil,omitempty" name:"CreateTime"`

	// Update time. The time format follows the ISO 8601 standard and is represented in Coordinated Universal Time (UTC).
	UpdateTime *string `json:"UpdateTime,omitnil,omitempty" name:"UpdateTime"`
}

type ErrorPageReference 

type ErrorPageReference struct {
	// Referenced business ID, such as the custom block rule ID.
	BusinessId *string `json:"BusinessId,omitnil,omitempty" name:"BusinessId"`
}

type ExceptConfig 

type ExceptConfig struct {
	// Whether to enable configuration. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// The settings of the exception rule. If it is null, the settings that were last configured will be used.
	// Note: This field may return null, indicating that no valid values can be obtained.
	ExceptUserRules []*ExceptUserRule `json:"ExceptUserRules,omitnil,omitempty" name:"ExceptUserRules"`
}

type ExceptUserRule 

type ExceptUserRule struct {
	// The rule name.
	RuleName *string `json:"RuleName,omitnil,omitempty" name:"RuleName"`

	// The rule action. It only supports the value `skip`, which indicates skipping all managed rules.
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`

	// The rule status. Values:
	// <li>`on`: Enabled</li>
	// <li>`off`: Disabled</li>
	RuleStatus *string `json:"RuleStatus,omitnil,omitempty" name:"RuleStatus"`

	// The rule ID, which is automatically created and only used as an output parameter.
	RuleID *int64 `json:"RuleID,omitnil,omitempty" name:"RuleID"`

	// The update time. If it is null, the current date and time is recorded.
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	UpdateTime *string `json:"UpdateTime,omitnil,omitempty" name:"UpdateTime"`

	// The matching condition.
	// Note: This field may return null, indicating that no valid values can be obtained.
	ExceptUserRuleConditions []*ExceptUserRuleCondition `json:"ExceptUserRuleConditions,omitnil,omitempty" name:"ExceptUserRuleConditions"`

	// The scope to which the exception rule applies.
	// Note: This field may return null, indicating that no valid values can be obtained.
	ExceptUserRuleScope *ExceptUserRuleScope `json:"ExceptUserRuleScope,omitnil,omitempty" name:"ExceptUserRuleScope"`

	// The rule priority. Value range: 0-100. If it is null, it defaults to 0.
	RulePriority *int64 `json:"RulePriority,omitnil,omitempty" name:"RulePriority"`
}

type ExceptUserRuleCondition 

type ExceptUserRuleCondition struct {
	// The field to match. Values:
	// <li>`host`: Request domain name</li>
	// <li>`sip`: Client IP</li>
	// <li>`ua`: User-Agent</li>
	// <li>`cookie`: Cookie</li>
	// <li>`cgi`: CGI script</li>
	// <li>`xff`: XFF header</li>
	// <li>`url`: Request URL</li>
	// <li>`accept`: Request content type</li>
	// <li>`method`: Request method</li>
	// <li>`header`: Request header</li>
	// <li>`sip_proto`: Network layer protocol</li>
	MatchFrom *string `json:"MatchFrom,omitnil,omitempty" name:"MatchFrom"`

	// The parameter of the field. Only when `MatchFrom = header`, the key contained in the header can be passed.
	MatchParam *string `json:"MatchParam,omitnil,omitempty" name:"MatchParam"`

	// The logical operator. Values:
	// <li>`equal`: String equals</li>
	// <li>`not_equal`: Value not equals</li>
	// <li>`include`: String contains</li>
	// <li>`not_include`: String not contains</li>
	// <li>`match`: IP matches</li>
	// <li>`not_match`: IP not matches</li>
	// <li>`include_area`: Regions contain</li>
	// <li>`is_empty`: Value left empty</li>
	// <li>`not_exists`: Key fields not exist</li>
	// <li>`regexp`: Regex matches</li>
	// <li>`len_gt`: Value greater than</li>
	// <li>`len_lt`: Value smaller than</li>
	// <li>`len_eq`: Value equals</li>
	// <li>`match_prefix`: Prefix matches</li>
	// <li>`match_suffix`: Suffix matches</li>
	// <li>`wildcard`: Wildcard</li>
	Operator *string `json:"Operator,omitnil,omitempty" name:"Operator"`

	// The value of the parameter.
	MatchContent *string `json:"MatchContent,omitnil,omitempty" name:"MatchContent"`
}

type ExceptUserRuleScope 

type ExceptUserRuleScope struct {
	// Exception mode. Values:
	// <li>`complete`: Skip the exception rule for full requests.</li>
	// <li>`partial`: Skip the exception rule for partial requests.</li>
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// The module to be activated. Values:
	// <li>`waf`: Tencent Cloud-managed rules</li>
	// <li>`rate`: Rate limiting rules</li>
	// <li>`acl`: Custom rule</li>
	// <li>`cc`: CC attack defense</li>
	// <li>`bot`: Bot protection</li>
	// Note: this field may return `null`, indicating that no valid value is obtained.
	Modules []*string `json:"Modules,omitnil,omitempty" name:"Modules"`

	// Module settings of the exception rule. If it is null, the settings that were last configured will be used.
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	PartialModules []*PartialModule `json:"PartialModules,omitnil,omitempty" name:"PartialModules"`

	// Condition settings of the exception rule. If it is null, the settings that were last configured will be used.
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	SkipConditions []*SkipCondition `json:"SkipConditions,omitnil,omitempty" name:"SkipConditions"`
}

type FailReason 

type FailReason struct {
	// Failure reason.
	Reason *string `json:"Reason,omitnil,omitempty" name:"Reason"`

	// List of resources failed to be processed.
	Targets []*string `json:"Targets,omitnil,omitempty" name:"Targets"`
}

type FileAscriptionInfo 

type FileAscriptionInfo struct {
	// Directory of the verification file.
	IdentifyPath *string `json:"IdentifyPath,omitnil,omitempty" name:"IdentifyPath"`

	// Content of the verification file.
	IdentifyContent *string `json:"IdentifyContent,omitnil,omitempty" name:"IdentifyContent"`
}

type FileVerification 

type FileVerification struct {
	// EdgeOne obtains the file verification information in the format of "Scheme + Host + URL Path", (e.g. https://www.example.com/.well-known/teo-verification/z12h416twn.txt). This field is the URL path section of the URL you need to create.
	Path *string `json:"Path,omitnil,omitempty" name:"Path"`

	// Content of the verification file. The contents of this field need to be filled into the text file returned by `Path`.
	Content *string `json:"Content,omitnil,omitempty" name:"Content"`
}

type Filter 

type Filter struct {
	// Fields to be filtered.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// Value of the filtered field.
	Values []*string `json:"Values,omitnil,omitempty" name:"Values"`
}

type FirstPartConfig 

type FirstPartConfig struct {
	// Switch. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// The transfer period threshold of the first 8 KB. If the threshold is reached, it’s considered a slow attack. Default: `5`.
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	StatTime *uint64 `json:"StatTime,omitnil,omitempty" name:"StatTime"`
}

type FollowOrigin 

type FollowOrigin struct {
	// Whether to enable the configuration of following the origin server. Valid values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// Whether to cache when an origin server does not return the Cache-Control header. This field is required when Switch is on; otherwise, it is ineffective. Valid values:
	// <li>on: Cache.</li>
	// <li>off: Do not cache.</li>
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	DefaultCache *string `json:"DefaultCache,omitnil,omitempty" name:"DefaultCache"`

	// Whether to use the default caching policy when an origin server does not return the Cache-Control header. This field is required when DefaultCache is set to on; otherwise, it is ineffective. When DefaultCacheTime is not 0, this field should be off. Valid values:
	// <li>on: Use the default caching policy.</li>
	// <li>off: Do not use the default caching policy.</li>
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	DefaultCacheStrategy *string `json:"DefaultCacheStrategy,omitnil,omitempty" name:"DefaultCacheStrategy"`

	// The default cache time in seconds when an origin server does not return the Cache-Control header. The value ranges from 0 to 315360000. This field is required when DefaultCache is set to on; otherwise, it is ineffective. When DefaultCacheStrategy is on, this field should be 0.
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	DefaultCacheTime *int64 `json:"DefaultCacheTime,omitnil,omitempty" name:"DefaultCacheTime"`
}

type ForceRedirect 

type ForceRedirect struct {
	// Whether to enable force HTTPS redirect. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// Redirect status code. Values:
	// <li>`301`: 301 redirect</li>
	// <li>`302`: 302 redirect</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	RedirectStatusCode *int64 `json:"RedirectStatusCode,omitnil,omitempty" name:"RedirectStatusCode"`
}

type Function 

type Function struct {
	// Function ID.
	FunctionId *string `json:"FunctionId,omitnil,omitempty" name:"FunctionId"`

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Function name.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// Function description.
	Remark *string `json:"Remark,omitnil,omitempty" name:"Remark"`

	// Function content.
	Content *string `json:"Content,omitnil,omitempty" name:"Content"`

	// Default domain name of a function.
	Domain *string `json:"Domain,omitnil,omitempty" name:"Domain"`

	// Creation time, which adopts Coordinated Universal Time (UTC) and follows the date and time format of the ISO 8601 standard.
	CreateTime *string `json:"CreateTime,omitnil,omitempty" name:"CreateTime"`

	// Modification time, which adopts Coordinated Universal Time (UTC) and follows the date and time format of the ISO 8601 standard.
	UpdateTime *string `json:"UpdateTime,omitnil,omitempty" name:"UpdateTime"`
}

type FunctionEnvironmentVariable 

type FunctionEnvironmentVariable struct {
	// Variable name, which should be unique and can only contain uppercase and lowercase letters, digits, and special characters including at signs (@), periods (.), hyphens (-), and underscores (_). Its maximum size is 64 bytes.
	Key *string `json:"Key,omitnil,omitempty" name:"Key"`

	// Variable value. Its maximum size is 5000 bytes. The default value is empty.
	Value *string `json:"Value,omitnil,omitempty" name:"Value"`

	// Variable type. Valid values:
	// <li>string: string type;</li>
	// <li>json: JSON object type.</li>Default value: string.
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`
}

type FunctionRule 

type FunctionRule struct {
	// Rule ID.
	RuleId *string `json:"RuleId,omitnil,omitempty" name:"RuleId"`

	// Rule condition list. There is an OR relationship between items in the list.
	FunctionRuleConditions []*FunctionRuleCondition `json:"FunctionRuleConditions,omitnil,omitempty" name:"FunctionRuleConditions"`

	// Function ID, specifying a function executed when a trigger rule condition is met.
	FunctionId *string `json:"FunctionId,omitnil,omitempty" name:"FunctionId"`

	// Rule description.
	Remark *string `json:"Remark,omitnil,omitempty" name:"Remark"`

	// Function name.
	FunctionName *string `json:"FunctionName,omitnil,omitempty" name:"FunctionName"`

	// Priority of a trigger rule for a function. The larger the value, the higher the priority.
	Priority *int64 `json:"Priority,omitnil,omitempty" name:"Priority"`

	// Creation time, which adopts Coordinated Universal Time (UTC) and follows the date and time format of the ISO 8601 standard.
	CreateTime *string `json:"CreateTime,omitnil,omitempty" name:"CreateTime"`

	// Update time, which adopts Coordinated Universal Time (UTC) and follows the date and time format of the ISO 8601 standard.
	UpdateTime *string `json:"UpdateTime,omitnil,omitempty" name:"UpdateTime"`
}

type FunctionRuleCondition 

type FunctionRuleCondition struct {
	// Condition of a trigger rule for an edge function. This condition is considered met if all items in the list are met.
	RuleConditions []*RuleCondition `json:"RuleConditions,omitnil,omitempty" name:"RuleConditions"`
}

type Grpc 

type Grpc struct {
	// Whether to enable gRPC support. Valid values:
	// <li>`on`: Enable;</li>
	// <li>`off`: Disable.</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`
}

type HandleFunctionRuntimeEnvironmentRequest 

type HandleFunctionRuntimeEnvironmentRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Function ID.
	FunctionId *string `json:"FunctionId,omitnil,omitempty" name:"FunctionId"`

	// Operation type. Valid values:
	// <li>setEnvironmentVariable: Set an environment variable. If the environment variable exists, it will be modified; otherwise, it will be added.</li>
	// <li>deleteEnvironmentVariable: Delete an environment variable.</li>
	// <li>clearEnvironmentVariable: Clear an environment variable.</li>
	// <li>resetEnvironmentVariable: Reset an environment variable.</li>
	Operation *string `json:"Operation,omitnil,omitempty" name:"Operation"`

	// Environment variable list. The runtime environment of a function supports up to 64 variables. This parameter is required when the value of Operation is setEnvironmentVariable, deleteEnvironmentVariable, or resetEnvironmentVariable.
	EnvironmentVariables []*FunctionEnvironmentVariable `json:"EnvironmentVariables,omitnil,omitempty" name:"EnvironmentVariables"`
}

func NewHandleFunctionRuntimeEnvironmentRequest 

func NewHandleFunctionRuntimeEnvironmentRequest() (request *HandleFunctionRuntimeEnvironmentRequest)

func (*HandleFunctionRuntimeEnvironmentRequest) FromJsonString 

func (r *HandleFunctionRuntimeEnvironmentRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*HandleFunctionRuntimeEnvironmentRequest) ToJsonString 

func (r *HandleFunctionRuntimeEnvironmentRequest) ToJsonString() string

type HandleFunctionRuntimeEnvironmentRequestParams 

type HandleFunctionRuntimeEnvironmentRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Function ID.
	FunctionId *string `json:"FunctionId,omitnil,omitempty" name:"FunctionId"`

	// Operation type. Valid values:
	// <li>setEnvironmentVariable: Set an environment variable. If the environment variable exists, it will be modified; otherwise, it will be added.</li>
	// <li>deleteEnvironmentVariable: Delete an environment variable.</li>
	// <li>clearEnvironmentVariable: Clear an environment variable.</li>
	// <li>resetEnvironmentVariable: Reset an environment variable.</li>
	Operation *string `json:"Operation,omitnil,omitempty" name:"Operation"`

	// Environment variable list. The runtime environment of a function supports up to 64 variables. This parameter is required when the value of Operation is setEnvironmentVariable, deleteEnvironmentVariable, or resetEnvironmentVariable.
	EnvironmentVariables []*FunctionEnvironmentVariable `json:"EnvironmentVariables,omitnil,omitempty" name:"EnvironmentVariables"`
}

Predefined struct for user

type HandleFunctionRuntimeEnvironmentResponse 

type HandleFunctionRuntimeEnvironmentResponse struct {
	*tchttp.BaseResponse
	Response *HandleFunctionRuntimeEnvironmentResponseParams `json:"Response"`
}

func NewHandleFunctionRuntimeEnvironmentResponse 

func NewHandleFunctionRuntimeEnvironmentResponse() (response *HandleFunctionRuntimeEnvironmentResponse)

func (*HandleFunctionRuntimeEnvironmentResponse) FromJsonString 

func (r *HandleFunctionRuntimeEnvironmentResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*HandleFunctionRuntimeEnvironmentResponse) ToJsonString 

func (r *HandleFunctionRuntimeEnvironmentResponse) ToJsonString() string

type HandleFunctionRuntimeEnvironmentResponseParams 

type HandleFunctionRuntimeEnvironmentResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user 

type Header struct {
	// HTTP header name.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// HTTP header value
	Value *string `json:"Value,omitnil,omitempty" name:"Value"`
}

type HealthChecker 

type HealthChecker struct {
	// Health check policy. Valid values:
	// <li>HTTP.</li>
	// <li>HTTPS.</li>
	// <li>TCP.</li>
	// <li>UDP.</li>
	// <li>ICMP Ping.</li>
	// <li>NoCheck.</li>
	// Note: NoCheck means the health check policy is not enabled.
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// Check port, which is required when Type = HTTP, Type = HTTPS, Type = TCP, or Type = UDP.
	Port *uint64 `json:"Port,omitnil,omitempty" name:"Port"`

	// Check frequency, in seconds. It indicates how often a health check task is initiated. Valid values: 30, 60, 180, 300, 600.
	Interval *uint64 `json:"Interval,omitnil,omitempty" name:"Interval"`

	// Timeout for each health check, in seconds. If the health check time exceeds this value, the check result is determined as "unhealthy". The default value is 5s, and the value should be less than Interval.
	Timeout *uint64 `json:"Timeout,omitnil,omitempty" name:"Timeout"`

	// Healthy state threshold, in the number of times. It indicates that if the consecutive health check results are "healthy" for a certain number of times, an origin server is considered "healthy". The default value is 3 times, with the minimum value of 1 time.
	HealthThreshold *uint64 `json:"HealthThreshold,omitnil,omitempty" name:"HealthThreshold"`

	// Unhealthy state threshold, in the number of times. It indicates that if the consecutive health check results are "unhealthy" for a certain number of times, an origin server is considered "unhealthy". The default value is 2 times.
	CriticalThreshold *uint64 `json:"CriticalThreshold,omitnil,omitempty" name:"CriticalThreshold"`

	// Probe path. This parameter is valid only when Type = HTTP or Type = HTTPS. It needs to include the complete host/path and should not contain a protocol, for example, www.example.com/test.
	Path *string `json:"Path,omitnil,omitempty" name:"Path"`

	// Request method. This parameter is valid only when Type = HTTP or Type = HTTPS. Valid values:
	// <li>GET.</li>
	// <li>HEAD.</li>
	Method *string `json:"Method,omitnil,omitempty" name:"Method"`

	// The status codes used to determine that the probe result is healthy when the probe node initiates a health check to an origin server. This parameter is valid only when Type = HTTP or Type = HTTPS.
	ExpectedCodes []*string `json:"ExpectedCodes,omitnil,omitempty" name:"ExpectedCodes"`

	// The custom HTTP request header carried by a probe request, with a maximum value of 10. This parameter is valid only when Type = HTTP or Type = HTTPS.
	Headers []*CustomizedHeader `json:"Headers,omitnil,omitempty" name:"Headers"`

	// Whether to follow 301/302 redirect. When enabled, 301/302 is considered a "healthy" status code, redirecting 3 times by default. This parameter is valid only when Type = HTTP or Type = HTTPS.
	FollowRedirect *string `json:"FollowRedirect,omitnil,omitempty" name:"FollowRedirect"`

	// The content sent by a health check. Only ASCII visible characters are allowed, with up to 500 characters. This parameter is valid only when Type = UDP.
	SendContext *string `json:"SendContext,omitnil,omitempty" name:"SendContext"`

	// The expected return result from an origin server during health check. Only ASCII visible characters are allowed, with up to 500 characters. This parameter is valid only when Type = UDP.
	RecvContext *string `json:"RecvContext,omitnil,omitempty" name:"RecvContext"`
}

type Hsts 

type Hsts struct {
	// Whether to enable the configuration. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// MaxAge (in seconds). The maximum value is 1 day.
	// Note: This field may return `null`, indicating that no valid values can be obtained.
	MaxAge *int64 `json:"MaxAge,omitnil,omitempty" name:"MaxAge"`

	// Whether to contain subdomain names. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	IncludeSubDomains *string `json:"IncludeSubDomains,omitnil,omitempty" name:"IncludeSubDomains"`

	// Whether to enable preloading. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	Preload *string `json:"Preload,omitnil,omitempty" name:"Preload"`
}

type Https 

type Https struct {
	// Whether to enable HTTP2. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	Http2 *string `json:"Http2,omitnil,omitempty" name:"Http2"`

	// Whether to enable OCSP. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	OcspStapling *string `json:"OcspStapling,omitnil,omitempty" name:"OcspStapling"`

	// TLS version. Valid values:
	// <li>`TLSv1`: TLSv1 version;</li>
	// <li>`TLSV1.1`: TLSv1.1 version;</li>
	// <li>`TLSV1.2`: TLSv1.2 version;</li>
	// <li>`TLSv1.3`: TLSv1.3 version.</li>Only consecutive versions can be enabled at the same time.
	// Note: This field may return `null`, indicating that no valid values can be obtained.
	TlsVersion []*string `json:"TlsVersion,omitnil,omitempty" name:"TlsVersion"`

	// HSTS Configuration
	// Note: This field may return null, indicating that no valid values can be obtained.
	Hsts *Hsts `json:"Hsts,omitnil,omitempty" name:"Hsts"`

	// The certificate configuration.
	// Note: This field may return null, indicating that no valid values can be obtained.
	CertInfo []*ServerCertInfo `json:"CertInfo,omitnil,omitempty" name:"CertInfo"`

	// Whether the certificate is managed by EdgeOne. Values:
	// <li>`apply`: Managed by EdgeOne.</li>
	// <li>`none`: Not managed by EdgeOne.</li>If it is left empty, the default value `none` is used.
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	ApplyType *string `json:"ApplyType,omitnil,omitempty" name:"ApplyType"`

	// The cipher suite, with values:
	// <li>loose-v2023: Provides high compatibility with general security, and supports TLS 1.0-1.3 cipher suites;</li>
	// <li>general-v2023: Provides relatively high compatibility with moderate security, and supports TLS 1.2-1.3 cipher suites;</li>
	// <li>strict-v2023: Provides high security, disables all cipher suites with security risks, and supports TLS 1.2-1.3 cipher suites.</li>
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	CipherSuite *string `json:"CipherSuite,omitnil,omitempty" name:"CipherSuite"`
}

type IPGroup 

type IPGroup struct {
	// Group ID. Enter `0`.
	GroupId *int64 `json:"GroupId,omitnil,omitempty" name:"GroupId"`

	// Group name.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// IP group content. Only supports IP and IP mask.
	Content []*string `json:"Content,omitnil,omitempty" name:"Content"`
}

type IPRegionInfo 

type IPRegionInfo struct {
	// IP address, IPV4 or IPV6.
	IP *string `json:"IP,omitnil,omitempty" name:"IP"`

	// Whether the IP belongs to an EdgeOne node. Valid values:
	// <li>yes: This IP belongs to an EdgeOne node;</li>
	// <li>no: This IP does not belong to an EdgeOne node.</li>
	IsEdgeOneIP *string `json:"IsEdgeOneIP,omitnil,omitempty" name:"IsEdgeOneIP"`
}

type IPWhitelist 

type IPWhitelist struct {
	// List of IPv4 addresses
	IPv4 []*string `json:"IPv4,omitnil,omitempty" name:"IPv4"`

	// List of IPv6 addresses
	IPv6 []*string `json:"IPv6,omitnil,omitempty" name:"IPv6"`
}

type Identification 

type Identification struct {
	// The site name.
	ZoneName *string `json:"ZoneName,omitnil,omitempty" name:"ZoneName"`

	// The subdomain name to be verified. To verify the ownership of a site, leave it blank.
	// Note: This field may return `null`, indicating that no valid values can be obtained.
	Domain *string `json:"Domain,omitnil,omitempty" name:"Domain"`

	// The verification status. Values:
	// <li>`pending`: The verification is ongoing.</li>
	// <li>`finished`: The verification completed.</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// Details of the DNS record.
	Ascription *AscriptionInfo `json:"Ascription,omitnil,omitempty" name:"Ascription"`

	// The NS record of the domain name.
	// Note: This field may return null, indicating that no valid values can be obtained.
	OriginalNameServers []*string `json:"OriginalNameServers,omitnil,omitempty" name:"OriginalNameServers"`

	// Details of the verification file.
	FileAscription *FileAscriptionInfo `json:"FileAscription,omitnil,omitempty" name:"FileAscription"`
}

type IdentifyZoneRequest 

type IdentifyZoneRequest struct {
	*tchttp.BaseRequest

	// The site name.
	ZoneName *string `json:"ZoneName,omitnil,omitempty" name:"ZoneName"`

	// A subdomain name under the site. Specify this field if you want to verify the ownership of a subdomain name. Otherwise you can leave it blank.
	Domain *string `json:"Domain,omitnil,omitempty" name:"Domain"`
}

func NewIdentifyZoneRequest 

func NewIdentifyZoneRequest() (request *IdentifyZoneRequest)

func (*IdentifyZoneRequest) FromJsonString 

func (r *IdentifyZoneRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*IdentifyZoneRequest) ToJsonString 

func (r *IdentifyZoneRequest) ToJsonString() string

type IdentifyZoneRequestParams 

type IdentifyZoneRequestParams struct {
	// The site name.
	ZoneName *string `json:"ZoneName,omitnil,omitempty" name:"ZoneName"`

	// A subdomain name under the site. Specify this field if you want to verify the ownership of a subdomain name. Otherwise you can leave it blank.
	Domain *string `json:"Domain,omitnil,omitempty" name:"Domain"`
}

Predefined struct for user

type IdentifyZoneResponse 

type IdentifyZoneResponse struct {
	*tchttp.BaseResponse
	Response *IdentifyZoneResponseParams `json:"Response"`
}

func NewIdentifyZoneResponse 

func NewIdentifyZoneResponse() (response *IdentifyZoneResponse)

func (*IdentifyZoneResponse) FromJsonString 

func (r *IdentifyZoneResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*IdentifyZoneResponse) ToJsonString 

func (r *IdentifyZoneResponse) ToJsonString() string

type IdentifyZoneResponseParams 

type IdentifyZoneResponseParams struct {
	// Details of the DNS record.
	Ascription *AscriptionInfo `json:"Ascription,omitnil,omitempty" name:"Ascription"`

	// Details of the verification file.
	FileAscription *FileAscriptionInfo `json:"FileAscription,omitnil,omitempty" name:"FileAscription"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ImageOptimize 

type ImageOptimize struct {
	// Whether to enable configuration. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`
}

type IncreasePlanQuotaRequest 

type IncreasePlanQuotaRequest struct {
	*tchttp.BaseRequest

	// Plan ID, formatted as edgeone-2unuvzjmmn2q.
	PlanId *string `json:"PlanId,omitnil,omitempty" name:"PlanId"`

	// The types of new plan quotas available include:<li> site: Number of sites;</li><li> precise_access_control_rule: the number of rules under "Web Protection - Custom Rules - Precision Matching Policy";</li><li> rate_limiting_rule: the number of rules under "Web Protection - Rate Limiting - Precision Rate Limiting Module". </li>
	QuotaType *string `json:"QuotaType,omitnil,omitempty" name:"QuotaType"`

	// Number of new quotas. The maximum number of quotas that can be added at one time is 100.
	QuotaNumber *int64 `json:"QuotaNumber,omitnil,omitempty" name:"QuotaNumber"`
}

func NewIncreasePlanQuotaRequest 

func NewIncreasePlanQuotaRequest() (request *IncreasePlanQuotaRequest)

func (*IncreasePlanQuotaRequest) FromJsonString 

func (r *IncreasePlanQuotaRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*IncreasePlanQuotaRequest) ToJsonString 

func (r *IncreasePlanQuotaRequest) ToJsonString() string

type IncreasePlanQuotaRequestParams 

type IncreasePlanQuotaRequestParams struct {
	// Plan ID, formatted as edgeone-2unuvzjmmn2q.
	PlanId *string `json:"PlanId,omitnil,omitempty" name:"PlanId"`

	// The types of new plan quotas available include:<li> site: Number of sites;</li><li> precise_access_control_rule: the number of rules under "Web Protection - Custom Rules - Precision Matching Policy";</li><li> rate_limiting_rule: the number of rules under "Web Protection - Rate Limiting - Precision Rate Limiting Module". </li>
	QuotaType *string `json:"QuotaType,omitnil,omitempty" name:"QuotaType"`

	// Number of new quotas. The maximum number of quotas that can be added at one time is 100.
	QuotaNumber *int64 `json:"QuotaNumber,omitnil,omitempty" name:"QuotaNumber"`
}

Predefined struct for user

type IncreasePlanQuotaResponse 

type IncreasePlanQuotaResponse struct {
	*tchttp.BaseResponse
	Response *IncreasePlanQuotaResponseParams `json:"Response"`
}

func NewIncreasePlanQuotaResponse 

func NewIncreasePlanQuotaResponse() (response *IncreasePlanQuotaResponse)

func (*IncreasePlanQuotaResponse) FromJsonString 

func (r *IncreasePlanQuotaResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*IncreasePlanQuotaResponse) ToJsonString 

func (r *IncreasePlanQuotaResponse) ToJsonString() string

type IncreasePlanQuotaResponseParams 

type IncreasePlanQuotaResponseParams struct {
	// Order number.
	DealName *string `json:"DealName,omitnil,omitempty" name:"DealName"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type IntelligenceRule 

type IntelligenceRule struct {
	// Switch. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// Items in a bot intelligence rule
	// Note: This field may return null, indicating that no valid values can be obtained.
	IntelligenceRuleItems []*IntelligenceRuleItem `json:"IntelligenceRuleItems,omitnil,omitempty" name:"IntelligenceRuleItems"`
}

type IntelligenceRuleItem 

type IntelligenceRuleItem struct {
	// The tag to categorize bots. Values:
	// <li>`evil_bot`: Malicious bot</li>
	// <li>`suspect_bot`: Suspected bot</li>
	// <li>`good_bot`: Good bot</li>
	// <li>`normal`: Normal request</li>
	Label *string `json:"Label,omitnil,omitempty" name:"Label"`

	// The action taken on bots. Values
	// <li>`drop`: Block</li>
	// <li>`trans`: Allow</li>
	// <li>`alg`: JavaScript challenge</li>
	// <li>`captcha`: Managed challenge</li>
	// <li>`monitor`: Observe</li>
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`
}

type IpTableConfig 

type IpTableConfig struct {
	// Switch. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// The settings of the basic access control rule. If it is null, the settings that were last configured will be used.
	// Note: This field may return null, indicating that no valid values can be obtained.
	IpTableRules []*IpTableRule `json:"IpTableRules,omitnil,omitempty" name:"IpTableRules"`
}

type IpTableRule 

type IpTableRule struct {
	// The action. Values:
	// <li>`drop`: Block</li>
	// <li>`trans`: Allow</li>
	// <li>`monitor`: Observe</li>
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`

	// The matching dimension. Values:
	// <li>`ip`: Match by IP.</li>
	// <li>`area`: Match by IP region.</li>
	MatchFrom *string `json:"MatchFrom,omitnil,omitempty" name:"MatchFrom"`

	// Matching method. It defaults to `equal` if it’s left empty.
	// Values:
	// <li>`is_empty`: The field is empty.</li>
	// <li>`not_exists`: The configuration item does not exist.</li>
	// <li>`include`: Include</li>
	// <li>`not_include`: Do not include</li>
	// <li>`equal`: Equal to</li>
	// <li>`not_equal`: Not equal to</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	Operator *string `json:"Operator,omitnil,omitempty" name:"Operator"`

	// The rule ID, which is only used as an output parameter.
	RuleID *int64 `json:"RuleID,omitnil,omitempty" name:"RuleID"`

	// The update time, which is only used as an output parameter.
	UpdateTime *string `json:"UpdateTime,omitnil,omitempty" name:"UpdateTime"`

	// The rule status. A null value indicates that the rule is enabled. Values:
	// <li>`on`: Enabled</li>
	// <li>`off`: Disabled</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// The rule name.
	// Note: This field may return null, indicating that no valid values can be obtained.
	RuleName *string `json:"RuleName,omitnil,omitempty" name:"RuleName"`

	// Matching content. It’s not required when `Operator` is `is_emty` or `not_exists`.
	MatchContent *string `json:"MatchContent,omitnil,omitempty" name:"MatchContent"`
}

type Ipv6 

type Ipv6 struct {
	// Whether to enable IPv6 access. Valid values:
	// <li>`on`: Enable;</li>
	// <li>`off`: Disable.</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`
}

type JITVideoProcess 

type JITVideoProcess struct {
	// Just-in-time media processing configuration switch. Valid values:
	// <li>on: Enable.</li>
	// <li>off: Disable.</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`
}

type L4OfflineLog 

type L4OfflineLog struct {
	// L4 proxy instance ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// Log query area. Valid values:
	// <li>`mainland`: Chinese mainland;</li>
	// <li>`overseas`: Global (outside the Chinese mainland). </li>
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// Log packet name.
	LogPacketName *string `json:"LogPacketName,omitnil,omitempty" name:"LogPacketName"`

	// Log download address.
	Url *string `json:"Url,omitnil,omitempty" name:"Url"`

	// (Disused) Log packaging time.
	LogTime *int64 `json:"LogTime,omitnil,omitempty" name:"LogTime"`

	// Start time of log packaging.
	LogStartTime *string `json:"LogStartTime,omitnil,omitempty" name:"LogStartTime"`

	// End time of the log package.
	LogEndTime *string `json:"LogEndTime,omitnil,omitempty" name:"LogEndTime"`

	// Log size (in bytes).
	Size *int64 `json:"Size,omitnil,omitempty" name:"Size"`
}

type L4Proxy 

type L4Proxy struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Layer 4 proxy instance ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// Layer 4 proxy instance name.
	ProxyName *string `json:"ProxyName,omitnil,omitempty" name:"ProxyName"`

	// Acceleration zone of the Layer 4 proxy instance.<li>mainland: Availability zone in the Chinese mainland;</li><li>overseas: Global availability zone (excluding the Chinese mainland);</li><li>global: Global availability zone.</li>
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// Access via CNAME.
	Cname *string `json:"Cname,omitnil,omitempty" name:"Cname"`

	// After the fixed IP address is enabled, this value will return the corresponding access IP address; if it is not enabled, this value will be empty.
	Ips []*string `json:"Ips,omitnil,omitempty" name:"Ips"`

	// Status of the Layer 4 proxy instance.<li>online: Enabled;</li>
	// <li>offline: Disabled;</li>
	// <li>progress: Deploying;</li>
	// <li>stopping: Disabling;</li>
	// <li>banned: Blocked;</li>
	// <li>fail: Failed to deploy or disable.</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// Specifies whether to enable IPv6 access.<li>on: Enable;</li> <li>off: Disable.</li>
	Ipv6 *string `json:"Ipv6,omitnil,omitempty" name:"Ipv6"`

	// Specifies whether to enable the fixed IP address.<li>on: Enable;</li> <li>off: Disable.</li>
	StaticIp *string `json:"StaticIp,omitnil,omitempty" name:"StaticIp"`

	// Specifies whether to enable network optimization in the Chinese mainland.<li>on: Enable</li> <li>off: Disable</li>
	AccelerateMainland *string `json:"AccelerateMainland,omitnil,omitempty" name:"AccelerateMainland"`

	// Security protection configuration.
	// Note: This field may return null, indicating that no valid value can be obtained.
	DDosProtectionConfig *DDosProtectionConfig `json:"DDosProtectionConfig,omitnil,omitempty" name:"DDosProtectionConfig"`

	// Number of forwarding rules under the Layer 4 proxy instance.
	L4ProxyRuleCount *int64 `json:"L4ProxyRuleCount,omitnil,omitempty" name:"L4ProxyRuleCount"`

	// Latest modification time.
	UpdateTime *string `json:"UpdateTime,omitnil,omitempty" name:"UpdateTime"`
}

type L4ProxyRemoteAuth 

type L4ProxyRemoteAuth struct {
	// Whether to enable L4 remote authentication. Valid values:
	// <li>on: Enable;</li>
	// <li>off: Disable.</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// Remote authentication service address, in the format of domain/ip:port, such as example.auth.com:8888.
	Address *string `json:"Address,omitnil,omitempty" name:"Address"`

	// Default origin-pull behavior based on L4 forwarding rules after the remote authentication service is disabled. Valid values:
	// <li>reject: Block and deny access;</li>
	// <li>allow: Allow access.</li>
	ServerFaultyBehavior *string `json:"ServerFaultyBehavior,omitnil,omitempty" name:"ServerFaultyBehavior"`
}

type L4ProxyRule 

type L4ProxyRule struct {
	// Forwarding rule ID.
	// Note: Do not fill in this parameter when L4ProxyRule is used as an input parameter in CreateL4ProxyRules; it must be filled in when L4ProxyRule is used as an input parameter in ModifyL4ProxyRules.
	RuleId *string `json:"RuleId,omitnil,omitempty" name:"RuleId"`

	// Forwarding protocol. Valid values:
	// <li>TCP: TCP protocol;</li>
	// <li>UDP: UDP protocol.</li>
	// Note: This parameter must be filled in when L4ProxyRule is used as an input parameter in CreateL4ProxyRules; it is optional when L4ProxyRule is used as an input parameter in ModifyL4ProxyRules. If not specified, it will retain its existing value.
	Protocol *string `json:"Protocol,omitnil,omitempty" name:"Protocol"`

	// Forwarding port, which can be set as follows:
	// <li>A single port, such as 80;</li>
	// <li>A range of ports, such as 81-85, representing ports 81, 82, 83, 84, 85.</li>
	// Note: This parameter must be filled in when L4ProxyRule is used as an input parameter in CreateL4ProxyRules; it is optional when L4ProxyRule is used as an input parameter in ModifyL4ProxyRules. If not specified, it will retain its existing value.
	PortRange []*string `json:"PortRange,omitnil,omitempty" name:"PortRange"`

	// Origin server type. Valid values:
	// <li>IP_DOMAIN: IP/Domain name origin server;</li>
	// <li>ORIGIN_GROUP: Origin server group;</li>
	// <li>LB: Cloud Load Balancer, currently only open to the allowlist.</li>
	// Note: This parameter must be filled in when L4ProxyRule is used as an input parameter in CreateL4ProxyRules; it is optional when L4ProxyRule is used as an input parameter in ModifyL4ProxyRules. If not specified, it will retain its existing value.
	OriginType *string `json:"OriginType,omitnil,omitempty" name:"OriginType"`

	// Origin server address.
	// <li>When OriginType is set to IP_DOMAIN, enter the IP address or domain name, such as 8.8.8.8 or test.com;</li>
	// <li>When OriginType is set to ORIGIN_GROUP, enter the origin server group ID, such as og-537y24vf5b41;</li>
	// <li>When OriginType is set to LB, enter the Cloud Load Balancer instance ID, such as lb-2qwk30xf7s9g.</li>
	// Note: This parameter must be filled in when L4ProxyRule is used as an input parameter in CreateL4ProxyRules; it is optional when L4ProxyRule is used as an input parameter in ModifyL4ProxyRules. If not specified, it will retain its existing value.
	OriginValue []*string `json:"OriginValue,omitnil,omitempty" name:"OriginValue"`

	// Origin server port, which can be set as follows:<li>A single port, such as 80;</li>
	// <li>A range of ports, such as 81-85, representing ports 81, 82, 83, 84, 85. When inputting a range of ports, ensure that the length corresponds with that of the forwarding port range. For example, if the forwarding port range is 80-90, this port range should be 90-100.</li>
	// Note: This parameter must be filled in when L4ProxyRule is used as an input parameter in CreateL4ProxyRules; it is optional when L4ProxyRule is used as an input parameter in ModifyL4ProxyRules. If not specified, it will retain its existing value.
	OriginPortRange *string `json:"OriginPortRange,omitnil,omitempty" name:"OriginPortRange"`

	// Transmission of the client IP address. Valid values:<li>TOA: Available only when Protocol=TCP;</li>
	// <li>PPV1: Transmission via Proxy Protocol V1. Available only when Protocol=TCP;</li>
	// <li>PPV2: Transmission via Proxy Protocol V2;</li>
	// <li>SPP: Transmission via Simple Proxy Protocol. Available only when Protocol=UDP;</li>
	// <li>OFF: No transmission.</li>
	// Note: This parameter is optional when L4ProxyRule is used as an input parameter in CreateL4ProxyRules, and if not specified, the default value OFF will be used; it is optional when L4ProxyRule is used as an input parameter in ModifyL4ProxyRules. If not specified, it will retain its existing value.
	ClientIPPassThroughMode *string `json:"ClientIPPassThroughMode,omitnil,omitempty" name:"ClientIPPassThroughMode"`

	// Specifies whether to enable session persistence. Valid values:
	// <li>on: Enable;</li>
	// <li>off: Disable.</li>
	// Note: This parameter is optional when L4ProxyRule is used as an input parameter in CreateL4ProxyRules, and if not specified, the default value off will be used; it is optional when L4ProxyRule is used as an input parameter in ModifyL4ProxyRules. If not specified, it will retain its existing value.
	SessionPersist *string `json:"SessionPersist,omitnil,omitempty" name:"SessionPersist"`

	// Session persistence period, with a range of 30-3600, measured in seconds.
	// Note: This parameter is optional when L4ProxyRule is used as an input parameter in CreateL4ProxyRules. It is valid only when SessionPersist is set to on and defaults to 3600 if not specified. It is optional when L4ProxyRule is used as an input parameter in ModifyL4ProxyRules. If not specified, it will retain its existing value.
	SessionPersistTime *uint64 `json:"SessionPersistTime,omitnil,omitempty" name:"SessionPersistTime"`

	// Rule tag. Accepts 1-50 arbitrary characters.
	// Note: This parameter is optional when L4ProxyRule is used as an input parameter in CreateL4ProxyRules; it is optional when L4ProxyRule is used as an input parameter in ModifyL4ProxyRules. If not specified, it will retain its existing value.
	RuleTag *string `json:"RuleTag,omitnil,omitempty" name:"RuleTag"`

	// Rule status. Valid values:<li>online: Enabled;</li>
	// <li>offline: Disabled;</li>
	// <li>progress: Deploying;</li>
	// <li>stopping: Disabling;</li>
	// <li>fail: Failed to deploy or disable.</li>
	// Note: Do not set this parameter when L4ProxyRule is used as an input parameter in CreateL4ProxyRules and ModifyL4ProxyRules.
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// BuID.
	BuId *string `json:"BuId,omitnil,omitempty" name:"BuId"`

	// Remote authentication information.
	// Note: RemoteAuth cannot be used as an input parameter in CreateL4ProxyRules or ModifyL4ProxyRules. If this parameter is input, it will be ignored. If the returned data of DescribeL4ProxyRules is empty, it indicates that remote authentication is disabled.
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	RemoteAuth *L4ProxyRemoteAuth `json:"RemoteAuth,omitnil,omitempty" name:"RemoteAuth"`
}

type L7OfflineLog 

type L7OfflineLog struct {
	// Log domain name.
	Domain *string `json:"Domain,omitnil,omitempty" name:"Domain"`

	// Log query area. Valid values:
	// <li>`mainland`: Chinese mainland;</li>
	// <li>`overseas`: Global (outside the Chinese mainland). </li>
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// Log packet name.
	LogPacketName *string `json:"LogPacketName,omitnil,omitempty" name:"LogPacketName"`

	// Log download address.
	Url *string `json:"Url,omitnil,omitempty" name:"Url"`

	// (Disused) Log packaging time.
	LogTime *int64 `json:"LogTime,omitnil,omitempty" name:"LogTime"`

	// Start time of log packaging.
	LogStartTime *string `json:"LogStartTime,omitnil,omitempty" name:"LogStartTime"`

	// End time of the log package.
	LogEndTime *string `json:"LogEndTime,omitnil,omitempty" name:"LogEndTime"`

	// Original log size (in bytes).
	Size *int64 `json:"Size,omitnil,omitempty" name:"Size"`
}

type LoadBalancer 

type LoadBalancer struct {
	// LoadBalancer ID.
	InstanceId *string `json:"InstanceId,omitnil,omitempty" name:"InstanceId"`

	// LoadBalancer name, which can contain 1 to 200 characters, including a-z, A-Z, 0-9, underscores (_), and hyphens (-).
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// LoadBalancer type. Valid values:
	// <li>HTTP: HTTP-specific LoadBalancer. It supports adding HTTP-specific and general origin server groups. It can only be referenced by site acceleration services (such as domain name service and rule engine).</li>
	// <li>GENERAL: general LoadBalancer. It only supports adding general origin server groups. It can be referenced by site acceleration services (such as domain name service and rule engine) and Layer-4 proxy.</li>
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// Health check policy. For details, refer to [Health Check Policies](https://intl.cloud.tencent.com/document/product/1552/104228?from_cn_redirect=1).
	HealthChecker *HealthChecker `json:"HealthChecker,omitnil,omitempty" name:"HealthChecker"`

	// Traffic scheduling policy among origin server groups. Valid values:
	// <li>Priority: Perform failover according to priority.</li>
	SteeringPolicy *string `json:"SteeringPolicy,omitnil,omitempty" name:"SteeringPolicy"`

	// Request retry policy when access to an origin server fails. For details, refer to [Introduction to Request Retry Strategy](https://intl.cloud.tencent.com/document/product/1552/104227?from_cn_redirect=1). Valid values:
	// <li>OtherOriginGroup: After a single request fails, retry with another origin server within the next lower priority origin server group.</li>
	// <li>OtherRecordInOriginGroup: After a single request fails, retry with another origin server within the same origin server group.</li>
	FailoverPolicy *string `json:"FailoverPolicy,omitnil,omitempty" name:"FailoverPolicy"`

	// Origin server group health status.
	OriginGroupHealthStatus []*OriginGroupHealthStatus `json:"OriginGroupHealthStatus,omitnil,omitempty" name:"OriginGroupHealthStatus"`

	// LoadBalancer status. Valid values:
	// <li>Pending: deploying.</li>
	// <li>Deleting: deleting.</li>
	// <li>Running: effective.</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// List of Layer-4 proxy instances bound to a LoadBalancer.
	L4UsedList []*string `json:"L4UsedList,omitnil,omitempty" name:"L4UsedList"`

	// List of Layer-7 domain names bound to a LoadBalancer.
	L7UsedList []*string `json:"L7UsedList,omitnil,omitempty" name:"L7UsedList"`
}

type LogFormat 

type LogFormat struct {
	// Predefined output format for log shipping. Valid values:
	// <li>json: Use JSON Lines as the predefined log output format. In each log entry, fields are displayed as key-value pairs.</li>
	// <li>csv: Use the predefined log output format csv, where each log entry only is presented as field values only, excluding field names. </li>
	FormatType *string `json:"FormatType,omitnil,omitempty" name:"FormatType"`

	// A string added before each log delivery batch. Each log delivery batch may contain multiple log records.
	BatchPrefix *string `json:"BatchPrefix,omitnil,omitempty" name:"BatchPrefix"`

	// A string appended after each log delivery batch.
	BatchSuffix *string `json:"BatchSuffix,omitnil,omitempty" name:"BatchSuffix"`

	// A string added before each log record.
	RecordPrefix *string `json:"RecordPrefix,omitnil,omitempty" name:"RecordPrefix"`

	// A string appended after each log record.
	RecordSuffix *string `json:"RecordSuffix,omitnil,omitempty" name:"RecordSuffix"`

	// A string inserted between log records as a separator. Valid values:
	// <li>\n: line break;</li>
	// <li>\t: tab character;</li>
	// <li>,: Half-width comma. </li>
	RecordDelimiter *string `json:"RecordDelimiter,omitnil,omitempty" name:"RecordDelimiter"`

	// A string inserted between fields as a separator within a single log record. Valid values:
	// <li>\t: tab character;</li>
	// <li>,: half-width comma;</li>
	// <li>;: Half-width semicolon. </li>
	FieldDelimiter *string `json:"FieldDelimiter,omitnil,omitempty" name:"FieldDelimiter"`
}

type MaxAge 

type MaxAge struct {
	// Whether to follow the origin server. Values:
	// <li>`on`: Follow the origin server and ignore the field MaxAgeTime;</li>
	// <li>`off`: Do not follow the origin server and apply the field MaxAgeTime.</li>
	FollowOrigin *string `json:"FollowOrigin,omitnil,omitempty" name:"FollowOrigin"`

	// Specifies the maximum amount of time (in seconds). The maximum value is 365 days.
	// Note: The value `0` means not to cache.
	MaxAgeTime *int64 `json:"MaxAgeTime,omitnil,omitempty" name:"MaxAgeTime"`
}

type ModifyAccelerationDomainRequest 

type ModifyAccelerationDomainRequest struct {
	*tchttp.BaseRequest

	// ID of the site related with the accelerated domain name.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Accelerated domain name
	DomainName *string `json:"DomainName,omitnil,omitempty" name:"DomainName"`

	// Details of the origin.
	OriginInfo *OriginInfo `json:"OriginInfo,omitnil,omitempty" name:"OriginInfo"`

	// Origin-pull protocol configuration. Values:
	// <li>`FOLLOW`: Follow the protocol of origin</li>
	// <li>`HTTP`: Send requests to the origin over HTTP</li>
	// <li>`HTTPS`: Send requests to the origin over HTTPS</li>
	// <li>The original configuration applies if this field is not specified.</li>
	OriginProtocol *string `json:"OriginProtocol,omitnil,omitempty" name:"OriginProtocol"`

	// Ports for HTTP origin-pull requests. Range: 1-65535. It takes effect when `OriginProtocol=FOLLOW/HTTP`. The original configuration is used if it's not specified.
	HttpOriginPort *uint64 `json:"HttpOriginPort,omitnil,omitempty" name:"HttpOriginPort"`

	// Ports for HTTPS origin-pull requests. Range: 1-65535. It takes effect when `OriginProtocol=FOLLOW/HTTPS`. The original configuration is used if it's not specified.
	HttpsOriginPort *uint64 `json:"HttpsOriginPort,omitnil,omitempty" name:"HttpsOriginPort"`

	// IPv6 status. Values:
	// <li>`follow`: Follow the IPv6 configuration of the site</li>
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	// <li>The original configuration applies if this field is not specified.</li>
	IPv6Status *string `json:"IPv6Status,omitnil,omitempty" name:"IPv6Status"`
}

func NewModifyAccelerationDomainRequest 

func NewModifyAccelerationDomainRequest() (request *ModifyAccelerationDomainRequest)

func (*ModifyAccelerationDomainRequest) FromJsonString 

func (r *ModifyAccelerationDomainRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyAccelerationDomainRequest) ToJsonString 

func (r *ModifyAccelerationDomainRequest) ToJsonString() string

type ModifyAccelerationDomainRequestParams 

type ModifyAccelerationDomainRequestParams struct {
	// ID of the site related with the accelerated domain name.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Accelerated domain name
	DomainName *string `json:"DomainName,omitnil,omitempty" name:"DomainName"`

	// Details of the origin.
	OriginInfo *OriginInfo `json:"OriginInfo,omitnil,omitempty" name:"OriginInfo"`

	// Origin-pull protocol configuration. Values:
	// <li>`FOLLOW`: Follow the protocol of origin</li>
	// <li>`HTTP`: Send requests to the origin over HTTP</li>
	// <li>`HTTPS`: Send requests to the origin over HTTPS</li>
	// <li>The original configuration applies if this field is not specified.</li>
	OriginProtocol *string `json:"OriginProtocol,omitnil,omitempty" name:"OriginProtocol"`

	// Ports for HTTP origin-pull requests. Range: 1-65535. It takes effect when `OriginProtocol=FOLLOW/HTTP`. The original configuration is used if it's not specified.
	HttpOriginPort *uint64 `json:"HttpOriginPort,omitnil,omitempty" name:"HttpOriginPort"`

	// Ports for HTTPS origin-pull requests. Range: 1-65535. It takes effect when `OriginProtocol=FOLLOW/HTTPS`. The original configuration is used if it's not specified.
	HttpsOriginPort *uint64 `json:"HttpsOriginPort,omitnil,omitempty" name:"HttpsOriginPort"`

	// IPv6 status. Values:
	// <li>`follow`: Follow the IPv6 configuration of the site</li>
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	// <li>The original configuration applies if this field is not specified.</li>
	IPv6Status *string `json:"IPv6Status,omitnil,omitempty" name:"IPv6Status"`
}

Predefined struct for user

type ModifyAccelerationDomainResponse 

type ModifyAccelerationDomainResponse struct {
	*tchttp.BaseResponse
	Response *ModifyAccelerationDomainResponseParams `json:"Response"`
}

func NewModifyAccelerationDomainResponse 

func NewModifyAccelerationDomainResponse() (response *ModifyAccelerationDomainResponse)

func (*ModifyAccelerationDomainResponse) FromJsonString 

func (r *ModifyAccelerationDomainResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyAccelerationDomainResponse) ToJsonString 

func (r *ModifyAccelerationDomainResponse) ToJsonString() string

type ModifyAccelerationDomainResponseParams 

type ModifyAccelerationDomainResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyAccelerationDomainStatusesRequest 

type ModifyAccelerationDomainStatusesRequest struct {
	*tchttp.BaseRequest

	// ID of the site related with the accelerated domain name.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// List of accelerated domain names to be modified.
	DomainNames []*string `json:"DomainNames,omitnil,omitempty" name:"DomainNames"`

	// Status of the accelerated domain name. Values:
	// <li>`online`: Enabled</li>
	// <li>`offline`: Disabled</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// Whether to force suspension when the domain name has associated resources (such as alias domain names and traffic scheduling policies). Values:
	// <li>`true`: Suspend the domain name and all associated resources.</li>
	// <li>`true`: Do not suspend the domain name and all associated resources.</li>Default value: `false`.
	Force *bool `json:"Force,omitnil,omitempty" name:"Force"`
}

func NewModifyAccelerationDomainStatusesRequest 

func NewModifyAccelerationDomainStatusesRequest() (request *ModifyAccelerationDomainStatusesRequest)

func (*ModifyAccelerationDomainStatusesRequest) FromJsonString 

func (r *ModifyAccelerationDomainStatusesRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyAccelerationDomainStatusesRequest) ToJsonString 

func (r *ModifyAccelerationDomainStatusesRequest) ToJsonString() string

type ModifyAccelerationDomainStatusesRequestParams 

type ModifyAccelerationDomainStatusesRequestParams struct {
	// ID of the site related with the accelerated domain name.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// List of accelerated domain names to be modified.
	DomainNames []*string `json:"DomainNames,omitnil,omitempty" name:"DomainNames"`

	// Status of the accelerated domain name. Values:
	// <li>`online`: Enabled</li>
	// <li>`offline`: Disabled</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// Whether to force suspension when the domain name has associated resources (such as alias domain names and traffic scheduling policies). Values:
	// <li>`true`: Suspend the domain name and all associated resources.</li>
	// <li>`true`: Do not suspend the domain name and all associated resources.</li>Default value: `false`.
	Force *bool `json:"Force,omitnil,omitempty" name:"Force"`
}

Predefined struct for user

type ModifyAccelerationDomainStatusesResponse 

type ModifyAccelerationDomainStatusesResponse struct {
	*tchttp.BaseResponse
	Response *ModifyAccelerationDomainStatusesResponseParams `json:"Response"`
}

func NewModifyAccelerationDomainStatusesResponse 

func NewModifyAccelerationDomainStatusesResponse() (response *ModifyAccelerationDomainStatusesResponse)

func (*ModifyAccelerationDomainStatusesResponse) FromJsonString 

func (r *ModifyAccelerationDomainStatusesResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyAccelerationDomainStatusesResponse) ToJsonString 

func (r *ModifyAccelerationDomainStatusesResponse) ToJsonString() string

type ModifyAccelerationDomainStatusesResponseParams 

type ModifyAccelerationDomainStatusesResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyAliasDomainRequest 

type ModifyAliasDomainRequest struct {
	*tchttp.BaseRequest

	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The alias domain name.
	AliasName *string `json:"AliasName,omitnil,omitempty" name:"AliasName"`

	// The target domain name.
	TargetName *string `json:"TargetName,omitnil,omitempty" name:"TargetName"`

	// Certificate configuration. Values:
	// <li>`none`: Off</li>
	// <li>`hosting`: Managed SSL certificate</li>
	// <li>`apply`: Free certificate</li>The original configuration will apply if this field is not specified.
	CertType *string `json:"CertType,omitnil,omitempty" name:"CertType"`

	// The certificate ID. This field is required when `CertType=hosting`.
	CertId []*string `json:"CertId,omitnil,omitempty" name:"CertId"`
}

func NewModifyAliasDomainRequest 

func NewModifyAliasDomainRequest() (request *ModifyAliasDomainRequest)

func (*ModifyAliasDomainRequest) FromJsonString 

func (r *ModifyAliasDomainRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyAliasDomainRequest) ToJsonString 

func (r *ModifyAliasDomainRequest) ToJsonString() string

type ModifyAliasDomainRequestParams 

type ModifyAliasDomainRequestParams struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The alias domain name.
	AliasName *string `json:"AliasName,omitnil,omitempty" name:"AliasName"`

	// The target domain name.
	TargetName *string `json:"TargetName,omitnil,omitempty" name:"TargetName"`

	// Certificate configuration. Values:
	// <li>`none`: Off</li>
	// <li>`hosting`: Managed SSL certificate</li>
	// <li>`apply`: Free certificate</li>The original configuration will apply if this field is not specified.
	CertType *string `json:"CertType,omitnil,omitempty" name:"CertType"`

	// The certificate ID. This field is required when `CertType=hosting`.
	CertId []*string `json:"CertId,omitnil,omitempty" name:"CertId"`
}

Predefined struct for user

type ModifyAliasDomainResponse 

type ModifyAliasDomainResponse struct {
	*tchttp.BaseResponse
	Response *ModifyAliasDomainResponseParams `json:"Response"`
}

func NewModifyAliasDomainResponse 

func NewModifyAliasDomainResponse() (response *ModifyAliasDomainResponse)

func (*ModifyAliasDomainResponse) FromJsonString 

func (r *ModifyAliasDomainResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyAliasDomainResponse) ToJsonString 

func (r *ModifyAliasDomainResponse) ToJsonString() string

type ModifyAliasDomainResponseParams 

type ModifyAliasDomainResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyAliasDomainStatusRequest 

type ModifyAliasDomainStatusRequest struct {
	*tchttp.BaseRequest

	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Status of the alias domain name. Values:
	// <li>`false`: Enable the alias domain name.</li>
	// <li>`true`: Disable the alias domain name.</li>
	Paused *bool `json:"Paused,omitnil,omitempty" name:"Paused"`

	// The alias domain name you want to modify its status. If it is left empty, the modify operation is not performed.
	AliasNames []*string `json:"AliasNames,omitnil,omitempty" name:"AliasNames"`
}

func NewModifyAliasDomainStatusRequest 

func NewModifyAliasDomainStatusRequest() (request *ModifyAliasDomainStatusRequest)

func (*ModifyAliasDomainStatusRequest) FromJsonString 

func (r *ModifyAliasDomainStatusRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyAliasDomainStatusRequest) ToJsonString 

func (r *ModifyAliasDomainStatusRequest) ToJsonString() string

type ModifyAliasDomainStatusRequestParams 

type ModifyAliasDomainStatusRequestParams struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Status of the alias domain name. Values:
	// <li>`false`: Enable the alias domain name.</li>
	// <li>`true`: Disable the alias domain name.</li>
	Paused *bool `json:"Paused,omitnil,omitempty" name:"Paused"`

	// The alias domain name you want to modify its status. If it is left empty, the modify operation is not performed.
	AliasNames []*string `json:"AliasNames,omitnil,omitempty" name:"AliasNames"`
}

Predefined struct for user

type ModifyAliasDomainStatusResponse 

type ModifyAliasDomainStatusResponse struct {
	*tchttp.BaseResponse
	Response *ModifyAliasDomainStatusResponseParams `json:"Response"`
}

func NewModifyAliasDomainStatusResponse 

func NewModifyAliasDomainStatusResponse() (response *ModifyAliasDomainStatusResponse)

func (*ModifyAliasDomainStatusResponse) FromJsonString 

func (r *ModifyAliasDomainStatusResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyAliasDomainStatusResponse) ToJsonString 

func (r *ModifyAliasDomainStatusResponse) ToJsonString() string

type ModifyAliasDomainStatusResponseParams 

type ModifyAliasDomainStatusResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyApplicationProxyRequest 

type ModifyApplicationProxyRequest struct {
	*tchttp.BaseRequest

	// Site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Proxy ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// Domain name or subdomain name when `ProxyType=hostname`;
	// Instance name when `ProxyType=instance`.
	ProxyName *string `json:"ProxyName,omitnil,omitempty" name:"ProxyName"`

	// The session persistence duration. Value range: 30-3600 (in seconds).
	// The original configuration will apply if this field is not specified.
	SessionPersistTime *uint64 `json:"SessionPersistTime,omitnil,omitempty" name:"SessionPersistTime"`

	// L4 proxy mode. Valid values:
	// <li>instance: Instance mode. </li>If it is not specified, instance is used by default.
	ProxyType *string `json:"ProxyType,omitnil,omitempty" name:"ProxyType"`

	// IPv6 access configuration. The original configuration will apply if it is not specified.
	Ipv6 *Ipv6 `json:"Ipv6,omitnil,omitempty" name:"Ipv6"`

	// Cross-MLC-border acceleration. The original configuration will apply if it is not specified.
	AccelerateMainland *AccelerateMainland `json:"AccelerateMainland,omitnil,omitempty" name:"AccelerateMainland"`
}

func NewModifyApplicationProxyRequest 

func NewModifyApplicationProxyRequest() (request *ModifyApplicationProxyRequest)

func (*ModifyApplicationProxyRequest) FromJsonString 

func (r *ModifyApplicationProxyRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyApplicationProxyRequest) ToJsonString 

func (r *ModifyApplicationProxyRequest) ToJsonString() string

type ModifyApplicationProxyRequestParams 

type ModifyApplicationProxyRequestParams struct {
	// Site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Proxy ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// Domain name or subdomain name when `ProxyType=hostname`;
	// Instance name when `ProxyType=instance`.
	ProxyName *string `json:"ProxyName,omitnil,omitempty" name:"ProxyName"`

	// The session persistence duration. Value range: 30-3600 (in seconds).
	// The original configuration will apply if this field is not specified.
	SessionPersistTime *uint64 `json:"SessionPersistTime,omitnil,omitempty" name:"SessionPersistTime"`

	// L4 proxy mode. Valid values:
	// <li>instance: Instance mode. </li>If it is not specified, instance is used by default.
	ProxyType *string `json:"ProxyType,omitnil,omitempty" name:"ProxyType"`

	// IPv6 access configuration. The original configuration will apply if it is not specified.
	Ipv6 *Ipv6 `json:"Ipv6,omitnil,omitempty" name:"Ipv6"`

	// Cross-MLC-border acceleration. The original configuration will apply if it is not specified.
	AccelerateMainland *AccelerateMainland `json:"AccelerateMainland,omitnil,omitempty" name:"AccelerateMainland"`
}

Predefined struct for user

type ModifyApplicationProxyResponse 

type ModifyApplicationProxyResponse struct {
	*tchttp.BaseResponse
	Response *ModifyApplicationProxyResponseParams `json:"Response"`
}

func NewModifyApplicationProxyResponse 

func NewModifyApplicationProxyResponse() (response *ModifyApplicationProxyResponse)

func (*ModifyApplicationProxyResponse) FromJsonString 

func (r *ModifyApplicationProxyResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyApplicationProxyResponse) ToJsonString 

func (r *ModifyApplicationProxyResponse) ToJsonString() string

type ModifyApplicationProxyResponseParams 

type ModifyApplicationProxyResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyApplicationProxyRuleRequest 

type ModifyApplicationProxyRuleRequest struct {
	*tchttp.BaseRequest

	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The proxy ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// The rule ID.
	RuleId *string `json:"RuleId,omitnil,omitempty" name:"RuleId"`

	// Origin server type. Valid values:
	// <li>custom: Manually added;</li>
	// <li>origins: Origin server group.</li>
	OriginType *string `json:"OriginType,omitnil,omitempty" name:"OriginType"`

	// The access port, which can be:
	// <li>A single port, such as 80</li>
	// <li>A port range, such as 81-90</li>
	Port []*string `json:"Port,omitnil,omitempty" name:"Port"`

	// The protocol. Values:
	// <li>`TCP`: TCP protocol</li>
	// <li>`UDP`: UDP protocol</li>The original configuration will apply if this field is not specified.
	Proto *string `json:"Proto,omitnil,omitempty" name:"Proto"`

	// Origin server information:
	// <li>When `OriginType=custom`, it indicates one or more origin servers, such as ["8.8.8.8","9.9.9.9"] or ["test.com"].</li>
	// <li>When `OriginType=origins`, it indicates an origin group ID, such as ["origin-537f5b41-162a-11ed-abaa-525400c5da15"].</li>
	//
	// The original configuration will apply if this field is not specified.
	OriginValue []*string `json:"OriginValue,omitnil,omitempty" name:"OriginValue"`

	// Passes the client IP. Values:
	// <li>`TOA`: Pass the client IP via TOA (available only when `Proto=TCP`).</li>
	// <li>`PPV1`: Pass the client IP via Proxy Protocol V1 (available only when `Proto=TCP`).</li>
	// <li>`PPV2`: Pass the client IP via Proxy Protocol V2.</li>
	// <li>`OFF`: Not pass the client IP.</li>If not specified, this field uses the default value OFF.
	ForwardClientIp *string `json:"ForwardClientIp,omitnil,omitempty" name:"ForwardClientIp"`

	// Whether to enable session persistence. Values:
	// <li>`true`: Enable</li>
	// <li>`false`: Disable</li>If it is left empty, the default value `false` is used.
	SessionPersist *bool `json:"SessionPersist,omitnil,omitempty" name:"SessionPersist"`

	// Duration for the persistent session. The value takes effect only when `SessionPersist = true`.
	SessionPersistTime *uint64 `json:"SessionPersistTime,omitnil,omitempty" name:"SessionPersistTime"`

	// The origin port, which can be:
	// <li>A single port, such as 80</li>
	// <li>A port range, such as 81-82</li>
	OriginPort *string `json:"OriginPort,omitnil,omitempty" name:"OriginPort"`

	// Rule tag. The original configuration will apply if it is not specified.
	RuleTag *string `json:"RuleTag,omitnil,omitempty" name:"RuleTag"`
}

func NewModifyApplicationProxyRuleRequest 

func NewModifyApplicationProxyRuleRequest() (request *ModifyApplicationProxyRuleRequest)

func (*ModifyApplicationProxyRuleRequest) FromJsonString 

func (r *ModifyApplicationProxyRuleRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyApplicationProxyRuleRequest) ToJsonString 

func (r *ModifyApplicationProxyRuleRequest) ToJsonString() string

type ModifyApplicationProxyRuleRequestParams 

type ModifyApplicationProxyRuleRequestParams struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The proxy ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// The rule ID.
	RuleId *string `json:"RuleId,omitnil,omitempty" name:"RuleId"`

	// Origin server type. Valid values:
	// <li>custom: Manually added;</li>
	// <li>origins: Origin server group.</li>
	OriginType *string `json:"OriginType,omitnil,omitempty" name:"OriginType"`

	// The access port, which can be:
	// <li>A single port, such as 80</li>
	// <li>A port range, such as 81-90</li>
	Port []*string `json:"Port,omitnil,omitempty" name:"Port"`

	// The protocol. Values:
	// <li>`TCP`: TCP protocol</li>
	// <li>`UDP`: UDP protocol</li>The original configuration will apply if this field is not specified.
	Proto *string `json:"Proto,omitnil,omitempty" name:"Proto"`

	// Origin server information:
	// <li>When `OriginType=custom`, it indicates one or more origin servers, such as ["8.8.8.8","9.9.9.9"] or ["test.com"].</li>
	// <li>When `OriginType=origins`, it indicates an origin group ID, such as ["origin-537f5b41-162a-11ed-abaa-525400c5da15"].</li>
	//
	// The original configuration will apply if this field is not specified.
	OriginValue []*string `json:"OriginValue,omitnil,omitempty" name:"OriginValue"`

	// Passes the client IP. Values:
	// <li>`TOA`: Pass the client IP via TOA (available only when `Proto=TCP`).</li>
	// <li>`PPV1`: Pass the client IP via Proxy Protocol V1 (available only when `Proto=TCP`).</li>
	// <li>`PPV2`: Pass the client IP via Proxy Protocol V2.</li>
	// <li>`OFF`: Not pass the client IP.</li>If not specified, this field uses the default value OFF.
	ForwardClientIp *string `json:"ForwardClientIp,omitnil,omitempty" name:"ForwardClientIp"`

	// Whether to enable session persistence. Values:
	// <li>`true`: Enable</li>
	// <li>`false`: Disable</li>If it is left empty, the default value `false` is used.
	SessionPersist *bool `json:"SessionPersist,omitnil,omitempty" name:"SessionPersist"`

	// Duration for the persistent session. The value takes effect only when `SessionPersist = true`.
	SessionPersistTime *uint64 `json:"SessionPersistTime,omitnil,omitempty" name:"SessionPersistTime"`

	// The origin port, which can be:
	// <li>A single port, such as 80</li>
	// <li>A port range, such as 81-82</li>
	OriginPort *string `json:"OriginPort,omitnil,omitempty" name:"OriginPort"`

	// Rule tag. The original configuration will apply if it is not specified.
	RuleTag *string `json:"RuleTag,omitnil,omitempty" name:"RuleTag"`
}

Predefined struct for user

type ModifyApplicationProxyRuleResponse 

type ModifyApplicationProxyRuleResponse struct {
	*tchttp.BaseResponse
	Response *ModifyApplicationProxyRuleResponseParams `json:"Response"`
}

func NewModifyApplicationProxyRuleResponse 

func NewModifyApplicationProxyRuleResponse() (response *ModifyApplicationProxyRuleResponse)

func (*ModifyApplicationProxyRuleResponse) FromJsonString 

func (r *ModifyApplicationProxyRuleResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyApplicationProxyRuleResponse) ToJsonString 

func (r *ModifyApplicationProxyRuleResponse) ToJsonString() string

type ModifyApplicationProxyRuleResponseParams 

type ModifyApplicationProxyRuleResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyApplicationProxyRuleStatusRequest 

type ModifyApplicationProxyRuleStatusRequest struct {
	*tchttp.BaseRequest

	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The proxy ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// The rule ID.
	RuleId *string `json:"RuleId,omitnil,omitempty" name:"RuleId"`

	// The rule status. Values:
	// <li>`offline`: Disabled</li>
	// <li>`online`: Enabled</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`
}

func NewModifyApplicationProxyRuleStatusRequest 

func NewModifyApplicationProxyRuleStatusRequest() (request *ModifyApplicationProxyRuleStatusRequest)

func (*ModifyApplicationProxyRuleStatusRequest) FromJsonString 

func (r *ModifyApplicationProxyRuleStatusRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyApplicationProxyRuleStatusRequest) ToJsonString 

func (r *ModifyApplicationProxyRuleStatusRequest) ToJsonString() string

type ModifyApplicationProxyRuleStatusRequestParams 

type ModifyApplicationProxyRuleStatusRequestParams struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The proxy ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// The rule ID.
	RuleId *string `json:"RuleId,omitnil,omitempty" name:"RuleId"`

	// The rule status. Values:
	// <li>`offline`: Disabled</li>
	// <li>`online`: Enabled</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`
}

Predefined struct for user

type ModifyApplicationProxyRuleStatusResponse 

type ModifyApplicationProxyRuleStatusResponse struct {
	*tchttp.BaseResponse
	Response *ModifyApplicationProxyRuleStatusResponseParams `json:"Response"`
}

func NewModifyApplicationProxyRuleStatusResponse 

func NewModifyApplicationProxyRuleStatusResponse() (response *ModifyApplicationProxyRuleStatusResponse)

func (*ModifyApplicationProxyRuleStatusResponse) FromJsonString 

func (r *ModifyApplicationProxyRuleStatusResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyApplicationProxyRuleStatusResponse) ToJsonString 

func (r *ModifyApplicationProxyRuleStatusResponse) ToJsonString() string

type ModifyApplicationProxyRuleStatusResponseParams 

type ModifyApplicationProxyRuleStatusResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyApplicationProxyStatusRequest 

type ModifyApplicationProxyStatusRequest struct {
	*tchttp.BaseRequest

	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The proxy ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// The proxy status. Values:
	// <li>`offline`: The proxy is disabled.</li>
	// <li>`online`: The proxy is enabled.</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`
}

func NewModifyApplicationProxyStatusRequest 

func NewModifyApplicationProxyStatusRequest() (request *ModifyApplicationProxyStatusRequest)

func (*ModifyApplicationProxyStatusRequest) FromJsonString 

func (r *ModifyApplicationProxyStatusRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyApplicationProxyStatusRequest) ToJsonString 

func (r *ModifyApplicationProxyStatusRequest) ToJsonString() string

type ModifyApplicationProxyStatusRequestParams 

type ModifyApplicationProxyStatusRequestParams struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The proxy ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// The proxy status. Values:
	// <li>`offline`: The proxy is disabled.</li>
	// <li>`online`: The proxy is enabled.</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`
}

Predefined struct for user

type ModifyApplicationProxyStatusResponse 

type ModifyApplicationProxyStatusResponse struct {
	*tchttp.BaseResponse
	Response *ModifyApplicationProxyStatusResponseParams `json:"Response"`
}

func NewModifyApplicationProxyStatusResponse 

func NewModifyApplicationProxyStatusResponse() (response *ModifyApplicationProxyStatusResponse)

func (*ModifyApplicationProxyStatusResponse) FromJsonString 

func (r *ModifyApplicationProxyStatusResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyApplicationProxyStatusResponse) ToJsonString 

func (r *ModifyApplicationProxyStatusResponse) ToJsonString() string

type ModifyApplicationProxyStatusResponseParams 

type ModifyApplicationProxyStatusResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyCustomErrorPageRequest 

type ModifyCustomErrorPageRequest struct {
	*tchttp.BaseRequest

	// Custom error page ID.
	PageId *string `json:"PageId,omitnil,omitempty" name:"PageId"`

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Custom error page name. The name must be 2-60 characters long.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// Custom error page description, not exceeding 60 characters.
	Description *string `json:"Description,omitnil,omitempty" name:"Description"`

	// Custom error page type, with values:<li>text/html. </li><li>application/json.</li><li>plain/text.</li><li>text/xml.</li>
	ContentType *string `json:"ContentType,omitnil,omitempty" name:"ContentType"`

	// Custom error page content, not exceeding 2 KB.
	Content *string `json:"Content,omitnil,omitempty" name:"Content"`
}

func NewModifyCustomErrorPageRequest 

func NewModifyCustomErrorPageRequest() (request *ModifyCustomErrorPageRequest)

func (*ModifyCustomErrorPageRequest) FromJsonString 

func (r *ModifyCustomErrorPageRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyCustomErrorPageRequest) ToJsonString 

func (r *ModifyCustomErrorPageRequest) ToJsonString() string

type ModifyCustomErrorPageRequestParams 

type ModifyCustomErrorPageRequestParams struct {
	// Custom error page ID.
	PageId *string `json:"PageId,omitnil,omitempty" name:"PageId"`

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Custom error page name. The name must be 2-60 characters long.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// Custom error page description, not exceeding 60 characters.
	Description *string `json:"Description,omitnil,omitempty" name:"Description"`

	// Custom error page type, with values:<li>text/html. </li><li>application/json.</li><li>plain/text.</li><li>text/xml.</li>
	ContentType *string `json:"ContentType,omitnil,omitempty" name:"ContentType"`

	// Custom error page content, not exceeding 2 KB.
	Content *string `json:"Content,omitnil,omitempty" name:"Content"`
}

Predefined struct for user

type ModifyCustomErrorPageResponse 

type ModifyCustomErrorPageResponse struct {
	*tchttp.BaseResponse
	Response *ModifyCustomErrorPageResponseParams `json:"Response"`
}

func NewModifyCustomErrorPageResponse 

func NewModifyCustomErrorPageResponse() (response *ModifyCustomErrorPageResponse)

func (*ModifyCustomErrorPageResponse) FromJsonString 

func (r *ModifyCustomErrorPageResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyCustomErrorPageResponse) ToJsonString 

func (r *ModifyCustomErrorPageResponse) ToJsonString() string

type ModifyCustomErrorPageResponseParams 

type ModifyCustomErrorPageResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyFunctionRequest 

type ModifyFunctionRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Function ID.
	FunctionId *string `json:"FunctionId,omitnil,omitempty" name:"FunctionId"`

	// Function description, which can contain up to 60 characters. If this parameter is not input, the original configuration is maintained.
	Remark *string `json:"Remark,omitnil,omitempty" name:"Remark"`

	// Function content, which currently only supports JavaScript code. Its maximum size is 5 MB. If this parameter is not input, the original configuration is maintained.
	Content *string `json:"Content,omitnil,omitempty" name:"Content"`
}

func NewModifyFunctionRequest 

func NewModifyFunctionRequest() (request *ModifyFunctionRequest)

func (*ModifyFunctionRequest) FromJsonString 

func (r *ModifyFunctionRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyFunctionRequest) ToJsonString 

func (r *ModifyFunctionRequest) ToJsonString() string

type ModifyFunctionRequestParams 

type ModifyFunctionRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Function ID.
	FunctionId *string `json:"FunctionId,omitnil,omitempty" name:"FunctionId"`

	// Function description, which can contain up to 60 characters. If this parameter is not input, the original configuration is maintained.
	Remark *string `json:"Remark,omitnil,omitempty" name:"Remark"`

	// Function content, which currently only supports JavaScript code. Its maximum size is 5 MB. If this parameter is not input, the original configuration is maintained.
	Content *string `json:"Content,omitnil,omitempty" name:"Content"`
}

Predefined struct for user

type ModifyFunctionResponse 

type ModifyFunctionResponse struct {
	*tchttp.BaseResponse
	Response *ModifyFunctionResponseParams `json:"Response"`
}

func NewModifyFunctionResponse 

func NewModifyFunctionResponse() (response *ModifyFunctionResponse)

func (*ModifyFunctionResponse) FromJsonString 

func (r *ModifyFunctionResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyFunctionResponse) ToJsonString 

func (r *ModifyFunctionResponse) ToJsonString() string

type ModifyFunctionResponseParams 

type ModifyFunctionResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyFunctionRulePriorityRequest 

type ModifyFunctionRulePriorityRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Rule ID list. All rule IDs after priority adjustment must be input. Multiple rules are executed from top to bottom. If this parameter is not input, the original priority order is maintained.
	RuleIds []*string `json:"RuleIds,omitnil,omitempty" name:"RuleIds"`
}

func NewModifyFunctionRulePriorityRequest 

func NewModifyFunctionRulePriorityRequest() (request *ModifyFunctionRulePriorityRequest)

func (*ModifyFunctionRulePriorityRequest) FromJsonString 

func (r *ModifyFunctionRulePriorityRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyFunctionRulePriorityRequest) ToJsonString 

func (r *ModifyFunctionRulePriorityRequest) ToJsonString() string

type ModifyFunctionRulePriorityRequestParams 

type ModifyFunctionRulePriorityRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Rule ID list. All rule IDs after priority adjustment must be input. Multiple rules are executed from top to bottom. If this parameter is not input, the original priority order is maintained.
	RuleIds []*string `json:"RuleIds,omitnil,omitempty" name:"RuleIds"`
}

Predefined struct for user

type ModifyFunctionRulePriorityResponse 

type ModifyFunctionRulePriorityResponse struct {
	*tchttp.BaseResponse
	Response *ModifyFunctionRulePriorityResponseParams `json:"Response"`
}

func NewModifyFunctionRulePriorityResponse 

func NewModifyFunctionRulePriorityResponse() (response *ModifyFunctionRulePriorityResponse)

func (*ModifyFunctionRulePriorityResponse) FromJsonString 

func (r *ModifyFunctionRulePriorityResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyFunctionRulePriorityResponse) ToJsonString 

func (r *ModifyFunctionRulePriorityResponse) ToJsonString() string

type ModifyFunctionRulePriorityResponseParams 

type ModifyFunctionRulePriorityResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyFunctionRuleRequest 

type ModifyFunctionRuleRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Rule ID.
	RuleId *string `json:"RuleId,omitnil,omitempty" name:"RuleId"`

	// Rule condition list. There is an OR relationship between different conditions of the same trigger rule. If this parameter is not input, the original configuration is maintained.
	FunctionRuleConditions []*FunctionRuleCondition `json:"FunctionRuleConditions,omitnil,omitempty" name:"FunctionRuleConditions"`

	// Function ID, specifying a function executed when a trigger rule condition is met. If this parameter is not input, the original configuration is maintained.
	FunctionId *string `json:"FunctionId,omitnil,omitempty" name:"FunctionId"`

	// Rule description, which can contain up to 60 characters. If this parameter is not input, the original configuration is maintained.
	Remark *string `json:"Remark,omitnil,omitempty" name:"Remark"`
}

func NewModifyFunctionRuleRequest 

func NewModifyFunctionRuleRequest() (request *ModifyFunctionRuleRequest)

func (*ModifyFunctionRuleRequest) FromJsonString 

func (r *ModifyFunctionRuleRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyFunctionRuleRequest) ToJsonString 

func (r *ModifyFunctionRuleRequest) ToJsonString() string

type ModifyFunctionRuleRequestParams 

type ModifyFunctionRuleRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Rule ID.
	RuleId *string `json:"RuleId,omitnil,omitempty" name:"RuleId"`

	// Rule condition list. There is an OR relationship between different conditions of the same trigger rule. If this parameter is not input, the original configuration is maintained.
	FunctionRuleConditions []*FunctionRuleCondition `json:"FunctionRuleConditions,omitnil,omitempty" name:"FunctionRuleConditions"`

	// Function ID, specifying a function executed when a trigger rule condition is met. If this parameter is not input, the original configuration is maintained.
	FunctionId *string `json:"FunctionId,omitnil,omitempty" name:"FunctionId"`

	// Rule description, which can contain up to 60 characters. If this parameter is not input, the original configuration is maintained.
	Remark *string `json:"Remark,omitnil,omitempty" name:"Remark"`
}

Predefined struct for user

type ModifyFunctionRuleResponse 

type ModifyFunctionRuleResponse struct {
	*tchttp.BaseResponse
	Response *ModifyFunctionRuleResponseParams `json:"Response"`
}

func NewModifyFunctionRuleResponse 

func NewModifyFunctionRuleResponse() (response *ModifyFunctionRuleResponse)

func (*ModifyFunctionRuleResponse) FromJsonString 

func (r *ModifyFunctionRuleResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyFunctionRuleResponse) ToJsonString 

func (r *ModifyFunctionRuleResponse) ToJsonString() string

type ModifyFunctionRuleResponseParams 

type ModifyFunctionRuleResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyHostsCertificateRequest 

type ModifyHostsCertificateRequest struct {
	*tchttp.BaseRequest

	// ID of the site.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Domain names that you need to modify the certificate configuration
	Hosts []*string `json:"Hosts,omitnil,omitempty" name:"Hosts"`

	// Certificate configuration mode. Values:
	// <li>`disable`: (Default) Do not configure the certificate</li>
	// <li>`eofreecert`: Use a free certificate provided by EdgeOne</li>
	// <li>`sslcert`: Configure an SSL certificate.</li>
	Mode *string `json:"Mode,omitnil,omitempty" name:"Mode"`

	// SSL certificate configuration. This parameter is effective only when the mode is sslcert. You only need to provide the CertId of the corresponding certificate. You can check the CertId from the [SSL Certificate List](https://console.cloud.tencent.com/ssl).
	ServerCertInfo []*ServerCertInfo `json:"ServerCertInfo,omitnil,omitempty" name:"ServerCertInfo"`

	// Whether the certificate is managed by EdgeOne. Values:
	// <li>`none`: Not managed by EdgeOne</li>
	// <li>`apply`: Managed by EdgeOne</li>
	// Default value: `none`.
	ApplyType *string `json:"ApplyType,omitnil,omitempty" name:"ApplyType"`

	// In the Edge mTLS scenario, this field represents the client's CA certificate, which is deployed at the EO entry side for authenticating the client access to EO nodes. The original configuration applies if this field is not specified.
	ClientCertInfo *MutualTLS `json:"ClientCertInfo,omitnil,omitempty" name:"ClientCertInfo"`
}

func NewModifyHostsCertificateRequest 

func NewModifyHostsCertificateRequest() (request *ModifyHostsCertificateRequest)

func (*ModifyHostsCertificateRequest) FromJsonString 

func (r *ModifyHostsCertificateRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyHostsCertificateRequest) ToJsonString 

func (r *ModifyHostsCertificateRequest) ToJsonString() string

type ModifyHostsCertificateRequestParams 

type ModifyHostsCertificateRequestParams struct {
	// ID of the site.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Domain names that you need to modify the certificate configuration
	Hosts []*string `json:"Hosts,omitnil,omitempty" name:"Hosts"`

	// Certificate configuration mode. Values:
	// <li>`disable`: (Default) Do not configure the certificate</li>
	// <li>`eofreecert`: Use a free certificate provided by EdgeOne</li>
	// <li>`sslcert`: Configure an SSL certificate.</li>
	Mode *string `json:"Mode,omitnil,omitempty" name:"Mode"`

	// SSL certificate configuration. This parameter is effective only when the mode is sslcert. You only need to provide the CertId of the corresponding certificate. You can check the CertId from the [SSL Certificate List](https://console.cloud.tencent.com/ssl).
	ServerCertInfo []*ServerCertInfo `json:"ServerCertInfo,omitnil,omitempty" name:"ServerCertInfo"`

	// Whether the certificate is managed by EdgeOne. Values:
	// <li>`none`: Not managed by EdgeOne</li>
	// <li>`apply`: Managed by EdgeOne</li>
	// Default value: `none`.
	//
	// Deprecated: ApplyType is deprecated.
	ApplyType *string `json:"ApplyType,omitnil,omitempty" name:"ApplyType"`

	// In the Edge mTLS scenario, this field represents the client's CA certificate, which is deployed at the EO entry side for authenticating the client access to EO nodes. The original configuration applies if this field is not specified.
	ClientCertInfo *MutualTLS `json:"ClientCertInfo,omitnil,omitempty" name:"ClientCertInfo"`
}

Predefined struct for user

type ModifyHostsCertificateResponse 

type ModifyHostsCertificateResponse struct {
	*tchttp.BaseResponse
	Response *ModifyHostsCertificateResponseParams `json:"Response"`
}

func NewModifyHostsCertificateResponse 

func NewModifyHostsCertificateResponse() (response *ModifyHostsCertificateResponse)

func (*ModifyHostsCertificateResponse) FromJsonString 

func (r *ModifyHostsCertificateResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyHostsCertificateResponse) ToJsonString 

func (r *ModifyHostsCertificateResponse) ToJsonString() string

type ModifyHostsCertificateResponseParams 

type ModifyHostsCertificateResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyL4ProxyRequest 

type ModifyL4ProxyRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Application ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// Specifies whether to enable IPv6 access. If this parameter is not filled, this configuration will not be modified. This configuration can only be enabled in certain acceleration zones and security protection configurations. For details, see [Creating an L4 Proxy Instance] (https://intl.cloud.tencent.com/document/product/1552/90025?from_cn_redirect=1). Valid values:<li>on: Enable;</li>
	// <li>off: Disable.</li>
	Ipv6 *string `json:"Ipv6,omitnil,omitempty" name:"Ipv6"`

	// Specifies whether to enable network optimization in the Chinese mainland. If this parameter is not filled, this configuration will not be modified. This configuration can only be enabled in certain acceleration zones and security protection configurations. For details, see [Creating an L4 Proxy Instance] (https://intl.cloud.tencent.com/document/product/1552/90025?from_cn_redirect=1). Valid values:<li>on: Enable;</li>
	// <li>off: Disable.</li>
	AccelerateMainland *string `json:"AccelerateMainland,omitnil,omitempty" name:"AccelerateMainland"`
}

func NewModifyL4ProxyRequest 

func NewModifyL4ProxyRequest() (request *ModifyL4ProxyRequest)

func (*ModifyL4ProxyRequest) FromJsonString 

func (r *ModifyL4ProxyRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyL4ProxyRequest) ToJsonString 

func (r *ModifyL4ProxyRequest) ToJsonString() string

type ModifyL4ProxyRequestParams 

type ModifyL4ProxyRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Application ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// Specifies whether to enable IPv6 access. If this parameter is not filled, this configuration will not be modified. This configuration can only be enabled in certain acceleration zones and security protection configurations. For details, see [Creating an L4 Proxy Instance] (https://intl.cloud.tencent.com/document/product/1552/90025?from_cn_redirect=1). Valid values:<li>on: Enable;</li>
	// <li>off: Disable.</li>
	Ipv6 *string `json:"Ipv6,omitnil,omitempty" name:"Ipv6"`

	// Specifies whether to enable network optimization in the Chinese mainland. If this parameter is not filled, this configuration will not be modified. This configuration can only be enabled in certain acceleration zones and security protection configurations. For details, see [Creating an L4 Proxy Instance] (https://intl.cloud.tencent.com/document/product/1552/90025?from_cn_redirect=1). Valid values:<li>on: Enable;</li>
	// <li>off: Disable.</li>
	AccelerateMainland *string `json:"AccelerateMainland,omitnil,omitempty" name:"AccelerateMainland"`
}

Predefined struct for user

type ModifyL4ProxyResponse 

type ModifyL4ProxyResponse struct {
	*tchttp.BaseResponse
	Response *ModifyL4ProxyResponseParams `json:"Response"`
}

func NewModifyL4ProxyResponse 

func NewModifyL4ProxyResponse() (response *ModifyL4ProxyResponse)

func (*ModifyL4ProxyResponse) FromJsonString 

func (r *ModifyL4ProxyResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyL4ProxyResponse) ToJsonString 

func (r *ModifyL4ProxyResponse) ToJsonString() string

type ModifyL4ProxyResponseParams 

type ModifyL4ProxyResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyL4ProxyRulesRequest 

type ModifyL4ProxyRulesRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Layer 4 proxy instance ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// List of forwarding rules. A single request supports up to 200 forwarding rules.
	// Note: When L4ProxyRule is used here, RuleId is a required field; Protocol, PortRange, OriginType, OriginValue, OriginPortRange, ClientIPPassThroughMode, SessionPersist, SessionPersistTime, and RuleTag are all optional fields. No modification is made when no value is specified for those fields. Status should not be filled.
	L4ProxyRules []*L4ProxyRule `json:"L4ProxyRules,omitnil,omitempty" name:"L4ProxyRules"`
}

func NewModifyL4ProxyRulesRequest 

func NewModifyL4ProxyRulesRequest() (request *ModifyL4ProxyRulesRequest)

func (*ModifyL4ProxyRulesRequest) FromJsonString 

func (r *ModifyL4ProxyRulesRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyL4ProxyRulesRequest) ToJsonString 

func (r *ModifyL4ProxyRulesRequest) ToJsonString() string

type ModifyL4ProxyRulesRequestParams 

type ModifyL4ProxyRulesRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Layer 4 proxy instance ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// List of forwarding rules. A single request supports up to 200 forwarding rules.
	// Note: When L4ProxyRule is used here, RuleId is a required field; Protocol, PortRange, OriginType, OriginValue, OriginPortRange, ClientIPPassThroughMode, SessionPersist, SessionPersistTime, and RuleTag are all optional fields. No modification is made when no value is specified for those fields. Status should not be filled.
	L4ProxyRules []*L4ProxyRule `json:"L4ProxyRules,omitnil,omitempty" name:"L4ProxyRules"`
}

Predefined struct for user

type ModifyL4ProxyRulesResponse 

type ModifyL4ProxyRulesResponse struct {
	*tchttp.BaseResponse
	Response *ModifyL4ProxyRulesResponseParams `json:"Response"`
}

func NewModifyL4ProxyRulesResponse 

func NewModifyL4ProxyRulesResponse() (response *ModifyL4ProxyRulesResponse)

func (*ModifyL4ProxyRulesResponse) FromJsonString 

func (r *ModifyL4ProxyRulesResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyL4ProxyRulesResponse) ToJsonString 

func (r *ModifyL4ProxyRulesResponse) ToJsonString() string

type ModifyL4ProxyRulesResponseParams 

type ModifyL4ProxyRulesResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyL4ProxyRulesStatusRequest 

type ModifyL4ProxyRulesStatusRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Layer 4 proxy instance ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// List of forwarding rule IDs. It supports up to 200 forwarding rules at a time.
	RuleIds []*string `json:"RuleIds,omitnil,omitempty" name:"RuleIds"`

	// Status of forwarding rules. Valid values:
	// <li>online: Enabled;</li>
	// <li>offline: Disabled.</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`
}

func NewModifyL4ProxyRulesStatusRequest 

func NewModifyL4ProxyRulesStatusRequest() (request *ModifyL4ProxyRulesStatusRequest)

func (*ModifyL4ProxyRulesStatusRequest) FromJsonString 

func (r *ModifyL4ProxyRulesStatusRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyL4ProxyRulesStatusRequest) ToJsonString 

func (r *ModifyL4ProxyRulesStatusRequest) ToJsonString() string

type ModifyL4ProxyRulesStatusRequestParams 

type ModifyL4ProxyRulesStatusRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Layer 4 proxy instance ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// List of forwarding rule IDs. It supports up to 200 forwarding rules at a time.
	RuleIds []*string `json:"RuleIds,omitnil,omitempty" name:"RuleIds"`

	// Status of forwarding rules. Valid values:
	// <li>online: Enabled;</li>
	// <li>offline: Disabled.</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`
}

Predefined struct for user

type ModifyL4ProxyRulesStatusResponse 

type ModifyL4ProxyRulesStatusResponse struct {
	*tchttp.BaseResponse
	Response *ModifyL4ProxyRulesStatusResponseParams `json:"Response"`
}

func NewModifyL4ProxyRulesStatusResponse 

func NewModifyL4ProxyRulesStatusResponse() (response *ModifyL4ProxyRulesStatusResponse)

func (*ModifyL4ProxyRulesStatusResponse) FromJsonString 

func (r *ModifyL4ProxyRulesStatusResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyL4ProxyRulesStatusResponse) ToJsonString 

func (r *ModifyL4ProxyRulesStatusResponse) ToJsonString() string

type ModifyL4ProxyRulesStatusResponseParams 

type ModifyL4ProxyRulesStatusResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyL4ProxyStatusRequest 

type ModifyL4ProxyStatusRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Layer 4 proxy instance ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// Layer 4 proxy instance status. Valid values:<li>online: Enabled;</li>
	// <li>offline: Disabled.</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`
}

func NewModifyL4ProxyStatusRequest 

func NewModifyL4ProxyStatusRequest() (request *ModifyL4ProxyStatusRequest)

func (*ModifyL4ProxyStatusRequest) FromJsonString 

func (r *ModifyL4ProxyStatusRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyL4ProxyStatusRequest) ToJsonString 

func (r *ModifyL4ProxyStatusRequest) ToJsonString() string

type ModifyL4ProxyStatusRequestParams 

type ModifyL4ProxyStatusRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Layer 4 proxy instance ID.
	ProxyId *string `json:"ProxyId,omitnil,omitempty" name:"ProxyId"`

	// Layer 4 proxy instance status. Valid values:<li>online: Enabled;</li>
	// <li>offline: Disabled.</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`
}

Predefined struct for user

type ModifyL4ProxyStatusResponse 

type ModifyL4ProxyStatusResponse struct {
	*tchttp.BaseResponse
	Response *ModifyL4ProxyStatusResponseParams `json:"Response"`
}

func NewModifyL4ProxyStatusResponse 

func NewModifyL4ProxyStatusResponse() (response *ModifyL4ProxyStatusResponse)

func (*ModifyL4ProxyStatusResponse) FromJsonString 

func (r *ModifyL4ProxyStatusResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyL4ProxyStatusResponse) ToJsonString 

func (r *ModifyL4ProxyStatusResponse) ToJsonString() string

type ModifyL4ProxyStatusResponseParams 

type ModifyL4ProxyStatusResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyLoadBalancerRequest 

type ModifyLoadBalancerRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// CLB instance ID.
	InstanceId *string `json:"InstanceId,omitnil,omitempty" name:"InstanceId"`

	// LoadBalancer name, which can contain 1 to 200 characters, including a-z, A-Z, 0-9, underscores (_), and hyphens (-). The original configuration applies if this field is not specified.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// List of origin server groups and their corresponding disaster recovery scheduling priorities. For details, refer to Sample Scenario in [Quickly Create Load Balancers](https://intl.cloud.tencent.com/document/product/1552/104223?from_cn_redirect=1). The original configuration applies if this field is not specified.
	OriginGroups []*OriginGroupInLoadBalancer `json:"OriginGroups,omitnil,omitempty" name:"OriginGroups"`

	// Health check policy. For details, refer to [Health Check Policies](https://intl.cloud.tencent.com/document/product/1552/104228?from_cn_redirect=1). The original configuration applies if this field is not specified.
	HealthChecker *HealthChecker `json:"HealthChecker,omitnil,omitempty" name:"HealthChecker"`

	// Traffic scheduling policy among origin server groups. Valid values:
	// <li>Priority: Perform failover according to priority.</li> The original configuration applies if this field is not specified.
	SteeringPolicy *string `json:"SteeringPolicy,omitnil,omitempty" name:"SteeringPolicy"`

	// Request retry policy when access to an origin server fails. For details, refer to [Introduction to Request Retry Strategy](https://intl.cloud.tencent.com/document/product/1552/104227?from_cn_redirect=1). Valid values:
	// <li>OtherOriginGroup: After a single request fails, retry with another origin server within the next lower priority origin server group.</li>
	// <li>OtherRecordInOriginGroup: After a single request fails, retry with another origin server within the same origin server group.</li> The original configuration applies if not specified.
	FailoverPolicy *string `json:"FailoverPolicy,omitnil,omitempty" name:"FailoverPolicy"`
}

func NewModifyLoadBalancerRequest 

func NewModifyLoadBalancerRequest() (request *ModifyLoadBalancerRequest)

func (*ModifyLoadBalancerRequest) FromJsonString 

func (r *ModifyLoadBalancerRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyLoadBalancerRequest) ToJsonString 

func (r *ModifyLoadBalancerRequest) ToJsonString() string

type ModifyLoadBalancerRequestParams 

type ModifyLoadBalancerRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// CLB instance ID.
	InstanceId *string `json:"InstanceId,omitnil,omitempty" name:"InstanceId"`

	// LoadBalancer name, which can contain 1 to 200 characters, including a-z, A-Z, 0-9, underscores (_), and hyphens (-). The original configuration applies if this field is not specified.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// List of origin server groups and their corresponding disaster recovery scheduling priorities. For details, refer to Sample Scenario in [Quickly Create Load Balancers](https://intl.cloud.tencent.com/document/product/1552/104223?from_cn_redirect=1). The original configuration applies if this field is not specified.
	OriginGroups []*OriginGroupInLoadBalancer `json:"OriginGroups,omitnil,omitempty" name:"OriginGroups"`

	// Health check policy. For details, refer to [Health Check Policies](https://intl.cloud.tencent.com/document/product/1552/104228?from_cn_redirect=1). The original configuration applies if this field is not specified.
	HealthChecker *HealthChecker `json:"HealthChecker,omitnil,omitempty" name:"HealthChecker"`

	// Traffic scheduling policy among origin server groups. Valid values:
	// <li>Priority: Perform failover according to priority.</li> The original configuration applies if this field is not specified.
	SteeringPolicy *string `json:"SteeringPolicy,omitnil,omitempty" name:"SteeringPolicy"`

	// Request retry policy when access to an origin server fails. For details, refer to [Introduction to Request Retry Strategy](https://intl.cloud.tencent.com/document/product/1552/104227?from_cn_redirect=1). Valid values:
	// <li>OtherOriginGroup: After a single request fails, retry with another origin server within the next lower priority origin server group.</li>
	// <li>OtherRecordInOriginGroup: After a single request fails, retry with another origin server within the same origin server group.</li> The original configuration applies if not specified.
	FailoverPolicy *string `json:"FailoverPolicy,omitnil,omitempty" name:"FailoverPolicy"`
}

Predefined struct for user

type ModifyLoadBalancerResponse 

type ModifyLoadBalancerResponse struct {
	*tchttp.BaseResponse
	Response *ModifyLoadBalancerResponseParams `json:"Response"`
}

func NewModifyLoadBalancerResponse 

func NewModifyLoadBalancerResponse() (response *ModifyLoadBalancerResponse)

func (*ModifyLoadBalancerResponse) FromJsonString 

func (r *ModifyLoadBalancerResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyLoadBalancerResponse) ToJsonString 

func (r *ModifyLoadBalancerResponse) ToJsonString() string

type ModifyLoadBalancerResponseParams 

type ModifyLoadBalancerResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyOriginGroupRequest 

type ModifyOriginGroupRequest struct {
	*tchttp.BaseRequest

	// Site ID
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// (Required) Origin group ID
	GroupId *string `json:"GroupId,omitnil,omitempty" name:"GroupId"`

	// Origin group name. It can contain 1 to 200 characters ([a-z], [A-Z], [0-9] and [_-]). The original configuration applies if this field is not specified.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// The origin grouptype. Values:
	// <li>`GENERAL`: General origin groups. It supports IPs and domain names. It can be referenced by DNS, Rule Engine, Layer 4 Proxy and General LoadBalancer.</li>
	// <li>`HTTP`: HTTP-specific origin groups. It supports IPs/domain names and object storage buckets. It can be referenced by acceleration domain names, rule engines and HTTP LoadBalancer. It cannot be referenced by L4 proxies. </li>The original configuration is used if it's not specified.
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// Origin information. The original configuration is used if it's not specified.
	Records []*OriginRecord `json:"Records,omitnil,omitempty" name:"Records"`

	// Host header used for origin-pull. It only works when `Type=HTTP`. If it's not specified, no specific Host header is configured. The `HostHeader` specified in `RuleEngine` takes a higher priority over this configuration.
	HostHeader *string `json:"HostHeader,omitnil,omitempty" name:"HostHeader"`
}

func NewModifyOriginGroupRequest 

func NewModifyOriginGroupRequest() (request *ModifyOriginGroupRequest)

func (*ModifyOriginGroupRequest) FromJsonString 

func (r *ModifyOriginGroupRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyOriginGroupRequest) ToJsonString 

func (r *ModifyOriginGroupRequest) ToJsonString() string

type ModifyOriginGroupRequestParams 

type ModifyOriginGroupRequestParams struct {
	// Site ID
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// (Required) Origin group ID
	GroupId *string `json:"GroupId,omitnil,omitempty" name:"GroupId"`

	// Origin group name. It can contain 1 to 200 characters ([a-z], [A-Z], [0-9] and [_-]). The original configuration applies if this field is not specified.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// The origin grouptype. Values:
	// <li>`GENERAL`: General origin groups. It supports IPs and domain names. It can be referenced by DNS, Rule Engine, Layer 4 Proxy and General LoadBalancer.</li>
	// <li>`HTTP`: HTTP-specific origin groups. It supports IPs/domain names and object storage buckets. It can be referenced by acceleration domain names, rule engines and HTTP LoadBalancer. It cannot be referenced by L4 proxies. </li>The original configuration is used if it's not specified.
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// Origin information. The original configuration is used if it's not specified.
	Records []*OriginRecord `json:"Records,omitnil,omitempty" name:"Records"`

	// Host header used for origin-pull. It only works when `Type=HTTP`. If it's not specified, no specific Host header is configured. The `HostHeader` specified in `RuleEngine` takes a higher priority over this configuration.
	HostHeader *string `json:"HostHeader,omitnil,omitempty" name:"HostHeader"`
}

Predefined struct for user

type ModifyOriginGroupResponse 

type ModifyOriginGroupResponse struct {
	*tchttp.BaseResponse
	Response *ModifyOriginGroupResponseParams `json:"Response"`
}

func NewModifyOriginGroupResponse 

func NewModifyOriginGroupResponse() (response *ModifyOriginGroupResponse)

func (*ModifyOriginGroupResponse) FromJsonString 

func (r *ModifyOriginGroupResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyOriginGroupResponse) ToJsonString 

func (r *ModifyOriginGroupResponse) ToJsonString() string

type ModifyOriginGroupResponseParams 

type ModifyOriginGroupResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyPlanRequest 

type ModifyPlanRequest struct {
	*tchttp.BaseRequest

	// Plan ID, formatted as edgeone-2unuvzjmmn2q.
	PlanId *string `json:"PlanId,omitnil,omitempty" name:"PlanId"`

	// Auto-renewal configuration item in a prepaid plan. If auto-renewal is enabled, the plan will be automatically renewed one day before it expires. This feature is only available for Personal, Basic, and Standard Edition Plans. If this field is not specified, the original configuration will be retained.
	RenewFlag *RenewFlag `json:"RenewFlag,omitnil,omitempty" name:"RenewFlag"`
}

func NewModifyPlanRequest 

func NewModifyPlanRequest() (request *ModifyPlanRequest)

func (*ModifyPlanRequest) FromJsonString 

func (r *ModifyPlanRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyPlanRequest) ToJsonString 

func (r *ModifyPlanRequest) ToJsonString() string

type ModifyPlanRequestParams 

type ModifyPlanRequestParams struct {
	// Plan ID, formatted as edgeone-2unuvzjmmn2q.
	PlanId *string `json:"PlanId,omitnil,omitempty" name:"PlanId"`

	// Auto-renewal configuration item in a prepaid plan. If auto-renewal is enabled, the plan will be automatically renewed one day before it expires. This feature is only available for Personal, Basic, and Standard Edition Plans. If this field is not specified, the original configuration will be retained.
	RenewFlag *RenewFlag `json:"RenewFlag,omitnil,omitempty" name:"RenewFlag"`
}

Predefined struct for user

type ModifyPlanResponse 

type ModifyPlanResponse struct {
	*tchttp.BaseResponse
	Response *ModifyPlanResponseParams `json:"Response"`
}

func NewModifyPlanResponse 

func NewModifyPlanResponse() (response *ModifyPlanResponse)

func (*ModifyPlanResponse) FromJsonString 

func (r *ModifyPlanResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyPlanResponse) ToJsonString 

func (r *ModifyPlanResponse) ToJsonString() string

type ModifyPlanResponseParams 

type ModifyPlanResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyRealtimeLogDeliveryTaskRequest 

type ModifyRealtimeLogDeliveryTaskRequest struct {
	*tchttp.BaseRequest

	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The ID of the real-time log delivery task.
	TaskId *string `json:"TaskId,omitnil,omitempty" name:"TaskId"`

	// The name of the real-time log delivery task, which is a combination of numbers, English letters, - and _, containing up to 200 characters. If this field is not filled in, the original configuration will be retained.
	TaskName *string `json:"TaskName,omitnil,omitempty" name:"TaskName"`

	// The status of the real-time log delivery task. Valid values:
	// <li>enabled: Enabled;</li>
	// <li>disabled: Disabled.</li>If this field is not filled in, the original configuration will be retained.
	DeliveryStatus *string `json:"DeliveryStatus,omitnil,omitempty" name:"DeliveryStatus"`

	// The list of entities (Layer 7 domains or Layer 4 proxy instances) corresponding to the real-time log delivery task. Valid value examples:
	// <li>Layer 7 domain: domain.example.com;</li>
	// <li>Layer 4 proxy instance: sid-2s69eb5wcms7.</li>If this field is not filled in, the original configuration will be retained.
	EntityList []*string `json:"EntityList,omitnil,omitempty" name:"EntityList"`

	// The list of predefined fields for delivery. If this field is not filled in, the original configuration will be retained.
	Fields []*string `json:"Fields,omitnil,omitempty" name:"Fields"`

	// The list of custom fields for shipping, which supports extracting specified content from HTTP request headers, response headers, cookies, and request bodies. If this parameter is not filled in, the original configuration will be retained. The name of each custom field should be unique and the maximum number of fields is 200. Up to 5 custom fields of the request body type can be added for a single real-time log push task. Currently, adding custom fields is supported only for site acceleration logs (LogType=domain).
	CustomFields []*CustomField `json:"CustomFields,omitnil,omitempty" name:"CustomFields"`

	// Log delivery filter conditions. If this field is not filled in, all logs will be delivered.
	DeliveryConditions []*DeliveryCondition `json:"DeliveryConditions,omitnil,omitempty" name:"DeliveryConditions"`

	// The sampling ratio in permille. Value range: 1 to 1000. For example, 605 represents a sampling ratio of 60.5%. If this field is not filled in, the original configuration will be retained.
	Sample *uint64 `json:"Sample,omitnil,omitempty" name:"Sample"`

	// Output format for log delivery. If this field is not specified, the original configuration will be retained. Specifically, when TaskType is cls, the value of LogFormat.FormatType can only be json, and other parameters in LogFormat will be ignored. It is recommended not to input LogFormat.
	LogFormat *LogFormat `json:"LogFormat,omitnil,omitempty" name:"LogFormat"`

	// The configuration information of the custom HTTP service. If this field is not filled in, the original configuration will be retained.
	CustomEndpoint *CustomEndpoint `json:"CustomEndpoint,omitnil,omitempty" name:"CustomEndpoint"`

	// The configuration information of the AWS S3-compatible bucket. If this field is not filled in, the original configuration will be retained.
	S3 *S3 `json:"S3,omitnil,omitempty" name:"S3"`
}

func NewModifyRealtimeLogDeliveryTaskRequest 

func NewModifyRealtimeLogDeliveryTaskRequest() (request *ModifyRealtimeLogDeliveryTaskRequest)

func (*ModifyRealtimeLogDeliveryTaskRequest) FromJsonString 

func (r *ModifyRealtimeLogDeliveryTaskRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyRealtimeLogDeliveryTaskRequest) ToJsonString 

func (r *ModifyRealtimeLogDeliveryTaskRequest) ToJsonString() string

type ModifyRealtimeLogDeliveryTaskRequestParams 

type ModifyRealtimeLogDeliveryTaskRequestParams struct {
	// Zone ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The ID of the real-time log delivery task.
	TaskId *string `json:"TaskId,omitnil,omitempty" name:"TaskId"`

	// The name of the real-time log delivery task, which is a combination of numbers, English letters, - and _, containing up to 200 characters. If this field is not filled in, the original configuration will be retained.
	TaskName *string `json:"TaskName,omitnil,omitempty" name:"TaskName"`

	// The status of the real-time log delivery task. Valid values:
	// <li>enabled: Enabled;</li>
	// <li>disabled: Disabled.</li>If this field is not filled in, the original configuration will be retained.
	DeliveryStatus *string `json:"DeliveryStatus,omitnil,omitempty" name:"DeliveryStatus"`

	// The list of entities (Layer 7 domains or Layer 4 proxy instances) corresponding to the real-time log delivery task. Valid value examples:
	// <li>Layer 7 domain: domain.example.com;</li>
	// <li>Layer 4 proxy instance: sid-2s69eb5wcms7.</li>If this field is not filled in, the original configuration will be retained.
	EntityList []*string `json:"EntityList,omitnil,omitempty" name:"EntityList"`

	// The list of predefined fields for delivery. If this field is not filled in, the original configuration will be retained.
	Fields []*string `json:"Fields,omitnil,omitempty" name:"Fields"`

	// The list of custom fields for shipping, which supports extracting specified content from HTTP request headers, response headers, cookies, and request bodies. If this parameter is not filled in, the original configuration will be retained. The name of each custom field should be unique and the maximum number of fields is 200. Up to 5 custom fields of the request body type can be added for a single real-time log push task. Currently, adding custom fields is supported only for site acceleration logs (LogType=domain).
	CustomFields []*CustomField `json:"CustomFields,omitnil,omitempty" name:"CustomFields"`

	// Log delivery filter conditions. If this field is not filled in, all logs will be delivered.
	DeliveryConditions []*DeliveryCondition `json:"DeliveryConditions,omitnil,omitempty" name:"DeliveryConditions"`

	// The sampling ratio in permille. Value range: 1 to 1000. For example, 605 represents a sampling ratio of 60.5%. If this field is not filled in, the original configuration will be retained.
	Sample *uint64 `json:"Sample,omitnil,omitempty" name:"Sample"`

	// Output format for log delivery. If this field is not specified, the original configuration will be retained. Specifically, when TaskType is cls, the value of LogFormat.FormatType can only be json, and other parameters in LogFormat will be ignored. It is recommended not to input LogFormat.
	LogFormat *LogFormat `json:"LogFormat,omitnil,omitempty" name:"LogFormat"`

	// The configuration information of the custom HTTP service. If this field is not filled in, the original configuration will be retained.
	CustomEndpoint *CustomEndpoint `json:"CustomEndpoint,omitnil,omitempty" name:"CustomEndpoint"`

	// The configuration information of the AWS S3-compatible bucket. If this field is not filled in, the original configuration will be retained.
	S3 *S3 `json:"S3,omitnil,omitempty" name:"S3"`
}

Predefined struct for user

type ModifyRealtimeLogDeliveryTaskResponse 

type ModifyRealtimeLogDeliveryTaskResponse struct {
	*tchttp.BaseResponse
	Response *ModifyRealtimeLogDeliveryTaskResponseParams `json:"Response"`
}

func NewModifyRealtimeLogDeliveryTaskResponse 

func NewModifyRealtimeLogDeliveryTaskResponse() (response *ModifyRealtimeLogDeliveryTaskResponse)

func (*ModifyRealtimeLogDeliveryTaskResponse) FromJsonString 

func (r *ModifyRealtimeLogDeliveryTaskResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyRealtimeLogDeliveryTaskResponse) ToJsonString 

func (r *ModifyRealtimeLogDeliveryTaskResponse) ToJsonString() string

type ModifyRealtimeLogDeliveryTaskResponseParams 

type ModifyRealtimeLogDeliveryTaskResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyRuleRequest 

type ModifyRuleRequest struct {
	*tchttp.BaseRequest

	// ID of the site
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The rule name. It is a string that can contain 1–255 characters.
	RuleName *string `json:"RuleName,omitnil,omitempty" name:"RuleName"`

	// The rule content.
	Rules []*Rule `json:"Rules,omitnil,omitempty" name:"Rules"`

	// The rule ID.
	RuleId *string `json:"RuleId,omitnil,omitempty" name:"RuleId"`

	// Rule status. Values:
	// <li>`enable`: Enabled</li>
	// <li>`disable`: Disabled</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// Tag of the rule.
	Tags []*string `json:"Tags,omitnil,omitempty" name:"Tags"`
}

func NewModifyRuleRequest 

func NewModifyRuleRequest() (request *ModifyRuleRequest)

func (*ModifyRuleRequest) FromJsonString 

func (r *ModifyRuleRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyRuleRequest) ToJsonString 

func (r *ModifyRuleRequest) ToJsonString() string

type ModifyRuleRequestParams 

type ModifyRuleRequestParams struct {
	// ID of the site
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The rule name. It is a string that can contain 1–255 characters.
	RuleName *string `json:"RuleName,omitnil,omitempty" name:"RuleName"`

	// The rule content.
	Rules []*Rule `json:"Rules,omitnil,omitempty" name:"Rules"`

	// The rule ID.
	RuleId *string `json:"RuleId,omitnil,omitempty" name:"RuleId"`

	// Rule status. Values:
	// <li>`enable`: Enabled</li>
	// <li>`disable`: Disabled</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// Tag of the rule.
	Tags []*string `json:"Tags,omitnil,omitempty" name:"Tags"`
}

Predefined struct for user

type ModifyRuleResponse 

type ModifyRuleResponse struct {
	*tchttp.BaseResponse
	Response *ModifyRuleResponseParams `json:"Response"`
}

func NewModifyRuleResponse 

func NewModifyRuleResponse() (response *ModifyRuleResponse)

func (*ModifyRuleResponse) FromJsonString 

func (r *ModifyRuleResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyRuleResponse) ToJsonString 

func (r *ModifyRuleResponse) ToJsonString() string

type ModifyRuleResponseParams 

type ModifyRuleResponseParams struct {
	// Rule ID
	RuleId *string `json:"RuleId,omitnil,omitempty" name:"RuleId"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifySecurityIPGroupRequest 

type ModifySecurityIPGroupRequest struct {
	*tchttp.BaseRequest

	// Site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// IP group configuration.
	IPGroup *IPGroup `json:"IPGroup,omitnil,omitempty" name:"IPGroup"`

	// Operation type. Valid values:
	// <li>`append`: Add information of `Content` to `IPGroup`;</li>
	// <li>`remove`: Delete information of `Content` from `IPGroup`;</li>
	// <li>`update`: Replace all information of `IPGroup` and modify the IPGroup name.</li>
	Mode *string `json:"Mode,omitnil,omitempty" name:"Mode"`
}

func NewModifySecurityIPGroupRequest 

func NewModifySecurityIPGroupRequest() (request *ModifySecurityIPGroupRequest)

func (*ModifySecurityIPGroupRequest) FromJsonString 

func (r *ModifySecurityIPGroupRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifySecurityIPGroupRequest) ToJsonString 

func (r *ModifySecurityIPGroupRequest) ToJsonString() string

type ModifySecurityIPGroupRequestParams 

type ModifySecurityIPGroupRequestParams struct {
	// Site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// IP group configuration.
	IPGroup *IPGroup `json:"IPGroup,omitnil,omitempty" name:"IPGroup"`

	// Operation type. Valid values:
	// <li>`append`: Add information of `Content` to `IPGroup`;</li>
	// <li>`remove`: Delete information of `Content` from `IPGroup`;</li>
	// <li>`update`: Replace all information of `IPGroup` and modify the IPGroup name.</li>
	Mode *string `json:"Mode,omitnil,omitempty" name:"Mode"`
}

Predefined struct for user

type ModifySecurityIPGroupResponse 

type ModifySecurityIPGroupResponse struct {
	*tchttp.BaseResponse
	Response *ModifySecurityIPGroupResponseParams `json:"Response"`
}

func NewModifySecurityIPGroupResponse 

func NewModifySecurityIPGroupResponse() (response *ModifySecurityIPGroupResponse)

func (*ModifySecurityIPGroupResponse) FromJsonString 

func (r *ModifySecurityIPGroupResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifySecurityIPGroupResponse) ToJsonString 

func (r *ModifySecurityIPGroupResponse) ToJsonString() string

type ModifySecurityIPGroupResponseParams 

type ModifySecurityIPGroupResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifySecurityPolicyRequest 

type ModifySecurityPolicyRequest struct {
	*tchttp.BaseRequest

	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Security configuration.
	SecurityConfig *SecurityConfig `json:"SecurityConfig,omitnil,omitempty" name:"SecurityConfig"`

	// Subdomain/application name.
	//
	// Note: When both this parameter and the TemplateId parameter are specified, this parameter will not take effect. Do not specify this parameter and the TemplateId parameter at the same time.
	Entity *string `json:"Entity,omitnil,omitempty" name:"Entity"`

	// Specifies the policy template ID, or the site's global policy.
	// - To configure a policy template, specify the policy template ID.
	// - To configure the site's global policy, use the @ZoneLevel@Domain parameter value.
	//
	// Note: When this parameter is used, the Entity parameter will not take effect. Do not use this parameter and the Entity parameter at the same time.
	TemplateId *string `json:"TemplateId,omitnil,omitempty" name:"TemplateId"`
}

func NewModifySecurityPolicyRequest 

func NewModifySecurityPolicyRequest() (request *ModifySecurityPolicyRequest)

func (*ModifySecurityPolicyRequest) FromJsonString 

func (r *ModifySecurityPolicyRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifySecurityPolicyRequest) ToJsonString 

func (r *ModifySecurityPolicyRequest) ToJsonString() string

type ModifySecurityPolicyRequestParams 

type ModifySecurityPolicyRequestParams struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Security configuration.
	SecurityConfig *SecurityConfig `json:"SecurityConfig,omitnil,omitempty" name:"SecurityConfig"`

	// Subdomain/application name.
	//
	// Note: When both this parameter and the TemplateId parameter are specified, this parameter will not take effect. Do not specify this parameter and the TemplateId parameter at the same time.
	Entity *string `json:"Entity,omitnil,omitempty" name:"Entity"`

	// Specifies the policy template ID, or the site's global policy.
	// - To configure a policy template, specify the policy template ID.
	// - To configure the site's global policy, use the @ZoneLevel@Domain parameter value.
	//
	// Note: When this parameter is used, the Entity parameter will not take effect. Do not use this parameter and the Entity parameter at the same time.
	TemplateId *string `json:"TemplateId,omitnil,omitempty" name:"TemplateId"`
}

Predefined struct for user

type ModifySecurityPolicyResponse 

type ModifySecurityPolicyResponse struct {
	*tchttp.BaseResponse
	Response *ModifySecurityPolicyResponseParams `json:"Response"`
}

func NewModifySecurityPolicyResponse 

func NewModifySecurityPolicyResponse() (response *ModifySecurityPolicyResponse)

func (*ModifySecurityPolicyResponse) FromJsonString 

func (r *ModifySecurityPolicyResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifySecurityPolicyResponse) ToJsonString 

func (r *ModifySecurityPolicyResponse) ToJsonString() string

type ModifySecurityPolicyResponseParams 

type ModifySecurityPolicyResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyZoneRequest 

type ModifyZoneRequest struct {
	*tchttp.BaseRequest

	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Site access method. Valid values:
	// <li>full: NS access.</li>
	// <li>partial: CNAME access. If the site is currently accessed with no domain name, it can be switched only to CNAME access.</li>
	// <li>dnsPodAccess: DNSPod hosted access. To use this access mode, your domain name should have been hosted on DNSPod.</li>If this parameter is not input, the original configuration is maintained.
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// The custom name servers. The original configuration applies if this field is not specified. It is not allowed to pass this field when a site is connected without using a domain name.
	VanityNameServers *VanityNameServers `json:"VanityNameServers,omitnil,omitempty" name:"VanityNameServers"`

	// The site alias. It can be up to 20 characters consisting of digits, letters, hyphens (-) and underscores (_).
	AliasZoneName *string `json:"AliasZoneName,omitnil,omitempty" name:"AliasZoneName"`

	// The region where the site requests access. Values:
	// <li> `global`: Global coverage</li>
	// <li> `mainland`: Chinese mainland</li>
	// <li> `overseas`: Outside the Chinese mainland </li>It is not allowed to pass this field when a site is connected without using a domain name.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// Name of the site. This field takes effect only when the site switches from domainless access to CNAME access.
	ZoneName *string `json:"ZoneName,omitnil,omitempty" name:"ZoneName"`
}

func NewModifyZoneRequest 

func NewModifyZoneRequest() (request *ModifyZoneRequest)

func (*ModifyZoneRequest) FromJsonString 

func (r *ModifyZoneRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyZoneRequest) ToJsonString 

func (r *ModifyZoneRequest) ToJsonString() string

type ModifyZoneRequestParams 

type ModifyZoneRequestParams struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Site access method. Valid values:
	// <li>full: NS access.</li>
	// <li>partial: CNAME access. If the site is currently accessed with no domain name, it can be switched only to CNAME access.</li>
	// <li>dnsPodAccess: DNSPod hosted access. To use this access mode, your domain name should have been hosted on DNSPod.</li>If this parameter is not input, the original configuration is maintained.
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// The custom name servers. The original configuration applies if this field is not specified. It is not allowed to pass this field when a site is connected without using a domain name.
	VanityNameServers *VanityNameServers `json:"VanityNameServers,omitnil,omitempty" name:"VanityNameServers"`

	// The site alias. It can be up to 20 characters consisting of digits, letters, hyphens (-) and underscores (_).
	AliasZoneName *string `json:"AliasZoneName,omitnil,omitempty" name:"AliasZoneName"`

	// The region where the site requests access. Values:
	// <li> `global`: Global coverage</li>
	// <li> `mainland`: Chinese mainland</li>
	// <li> `overseas`: Outside the Chinese mainland </li>It is not allowed to pass this field when a site is connected without using a domain name.
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// Name of the site. This field takes effect only when the site switches from domainless access to CNAME access.
	ZoneName *string `json:"ZoneName,omitnil,omitempty" name:"ZoneName"`
}

Predefined struct for user

type ModifyZoneResponse 

type ModifyZoneResponse struct {
	*tchttp.BaseResponse
	Response *ModifyZoneResponseParams `json:"Response"`
}

func NewModifyZoneResponse 

func NewModifyZoneResponse() (response *ModifyZoneResponse)

func (*ModifyZoneResponse) FromJsonString 

func (r *ModifyZoneResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyZoneResponse) ToJsonString 

func (r *ModifyZoneResponse) ToJsonString() string

type ModifyZoneResponseParams 

type ModifyZoneResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyZoneSettingRequest 

type ModifyZoneSettingRequest struct {
	*tchttp.BaseRequest

	// Site ID to modify.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Cache expiration time configuration
	// The original configuration will apply if this field is not specified.
	CacheConfig *CacheConfig `json:"CacheConfig,omitnil,omitempty" name:"CacheConfig"`

	// The node cache key configuration.
	// The original configuration will apply if this field is not specified.
	CacheKey *CacheKey `json:"CacheKey,omitnil,omitempty" name:"CacheKey"`

	// The browser cache configuration.
	// The original configuration will apply if this field is not specified.
	MaxAge *MaxAge `json:"MaxAge,omitnil,omitempty" name:"MaxAge"`

	// The offline cache configuration.
	// The original configuration will apply if this field is not specified.
	OfflineCache *OfflineCache `json:"OfflineCache,omitnil,omitempty" name:"OfflineCache"`

	// QUIC access configuration.
	// The original configuration will apply if it is not specified.
	Quic *Quic `json:"Quic,omitnil,omitempty" name:"Quic"`

	// POST transport configuration.
	// The original configuration will apply if it is not specified.
	PostMaxSize *PostMaxSize `json:"PostMaxSize,omitnil,omitempty" name:"PostMaxSize"`

	// The smart compression configuration.
	// The original configuration will apply if this field is not specified.
	Compression *Compression `json:"Compression,omitnil,omitempty" name:"Compression"`

	// HTTP2 origin-pull configuration.
	// The original configuration will apply if it is not specified.
	UpstreamHttp2 *UpstreamHttp2 `json:"UpstreamHttp2,omitnil,omitempty" name:"UpstreamHttp2"`

	// Force HTTPS redirect configuration.
	// The original configuration will apply if it is not specified.
	ForceRedirect *ForceRedirect `json:"ForceRedirect,omitnil,omitempty" name:"ForceRedirect"`

	// HTTPS acceleration configuration.
	// The original configuration will apply if it is not specified.
	Https *Https `json:"Https,omitnil,omitempty" name:"Https"`

	// The origin server configuration.
	// The original configuration will apply if this field is not specified.
	Origin *Origin `json:"Origin,omitnil,omitempty" name:"Origin"`

	// The smart acceleration configuration.
	// The original configuration will apply if this field is not specified.
	SmartRouting *SmartRouting `json:"SmartRouting,omitnil,omitempty" name:"SmartRouting"`

	// WebSocket configuration.
	// The original configuration will apply if it is not specified.
	WebSocket *WebSocket `json:"WebSocket,omitnil,omitempty" name:"WebSocket"`

	// Origin-pull client IP header configuration.
	// The original configuration will apply if it is not specified.
	ClientIpHeader *ClientIpHeader `json:"ClientIpHeader,omitnil,omitempty" name:"ClientIpHeader"`

	// The cache prefresh configuration.
	// The original configuration will apply if this field is not specified.
	CachePrefresh *CachePrefresh `json:"CachePrefresh,omitnil,omitempty" name:"CachePrefresh"`

	// Ipv6 access configuration.
	// The original configuration will apply if it is not specified.
	Ipv6 *Ipv6 `json:"Ipv6,omitnil,omitempty" name:"Ipv6"`

	// Whether to carry the location information of the client IP during origin-pull.
	// The original configuration will apply if it is not specified.
	ClientIpCountry *ClientIpCountry `json:"ClientIpCountry,omitnil,omitempty" name:"ClientIpCountry"`

	// Configuration of gRPC support.
	// The original configuration will apply if it is not specified.
	Grpc *Grpc `json:"Grpc,omitnil,omitempty" name:"Grpc"`

	// Image optimization.
	// It is disabled if this parameter is not specified.
	ImageOptimize *ImageOptimize `json:"ImageOptimize,omitnil,omitempty" name:"ImageOptimize"`

	// Standard debugging configuration.
	StandardDebug *StandardDebug `json:"StandardDebug,omitnil,omitempty" name:"StandardDebug"`

	// Just-in-time media processing configuration. The original configuration applies if this field is not specified.
	JITVideoProcess *JITVideoProcess `json:"JITVideoProcess,omitnil,omitempty" name:"JITVideoProcess"`
}

func NewModifyZoneSettingRequest 

func NewModifyZoneSettingRequest() (request *ModifyZoneSettingRequest)

func (*ModifyZoneSettingRequest) FromJsonString 

func (r *ModifyZoneSettingRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyZoneSettingRequest) ToJsonString 

func (r *ModifyZoneSettingRequest) ToJsonString() string

type ModifyZoneSettingRequestParams 

type ModifyZoneSettingRequestParams struct {
	// Site ID to modify.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// Cache expiration time configuration
	// The original configuration will apply if this field is not specified.
	CacheConfig *CacheConfig `json:"CacheConfig,omitnil,omitempty" name:"CacheConfig"`

	// The node cache key configuration.
	// The original configuration will apply if this field is not specified.
	CacheKey *CacheKey `json:"CacheKey,omitnil,omitempty" name:"CacheKey"`

	// The browser cache configuration.
	// The original configuration will apply if this field is not specified.
	MaxAge *MaxAge `json:"MaxAge,omitnil,omitempty" name:"MaxAge"`

	// The offline cache configuration.
	// The original configuration will apply if this field is not specified.
	OfflineCache *OfflineCache `json:"OfflineCache,omitnil,omitempty" name:"OfflineCache"`

	// QUIC access configuration.
	// The original configuration will apply if it is not specified.
	Quic *Quic `json:"Quic,omitnil,omitempty" name:"Quic"`

	// POST transport configuration.
	// The original configuration will apply if it is not specified.
	PostMaxSize *PostMaxSize `json:"PostMaxSize,omitnil,omitempty" name:"PostMaxSize"`

	// The smart compression configuration.
	// The original configuration will apply if this field is not specified.
	Compression *Compression `json:"Compression,omitnil,omitempty" name:"Compression"`

	// HTTP2 origin-pull configuration.
	// The original configuration will apply if it is not specified.
	UpstreamHttp2 *UpstreamHttp2 `json:"UpstreamHttp2,omitnil,omitempty" name:"UpstreamHttp2"`

	// Force HTTPS redirect configuration.
	// The original configuration will apply if it is not specified.
	ForceRedirect *ForceRedirect `json:"ForceRedirect,omitnil,omitempty" name:"ForceRedirect"`

	// HTTPS acceleration configuration.
	// The original configuration will apply if it is not specified.
	Https *Https `json:"Https,omitnil,omitempty" name:"Https"`

	// The origin server configuration.
	// The original configuration will apply if this field is not specified.
	Origin *Origin `json:"Origin,omitnil,omitempty" name:"Origin"`

	// The smart acceleration configuration.
	// The original configuration will apply if this field is not specified.
	SmartRouting *SmartRouting `json:"SmartRouting,omitnil,omitempty" name:"SmartRouting"`

	// WebSocket configuration.
	// The original configuration will apply if it is not specified.
	WebSocket *WebSocket `json:"WebSocket,omitnil,omitempty" name:"WebSocket"`

	// Origin-pull client IP header configuration.
	// The original configuration will apply if it is not specified.
	ClientIpHeader *ClientIpHeader `json:"ClientIpHeader,omitnil,omitempty" name:"ClientIpHeader"`

	// The cache prefresh configuration.
	// The original configuration will apply if this field is not specified.
	CachePrefresh *CachePrefresh `json:"CachePrefresh,omitnil,omitempty" name:"CachePrefresh"`

	// Ipv6 access configuration.
	// The original configuration will apply if it is not specified.
	Ipv6 *Ipv6 `json:"Ipv6,omitnil,omitempty" name:"Ipv6"`

	// Whether to carry the location information of the client IP during origin-pull.
	// The original configuration will apply if it is not specified.
	ClientIpCountry *ClientIpCountry `json:"ClientIpCountry,omitnil,omitempty" name:"ClientIpCountry"`

	// Configuration of gRPC support.
	// The original configuration will apply if it is not specified.
	Grpc *Grpc `json:"Grpc,omitnil,omitempty" name:"Grpc"`

	// Image optimization.
	// It is disabled if this parameter is not specified.
	ImageOptimize *ImageOptimize `json:"ImageOptimize,omitnil,omitempty" name:"ImageOptimize"`

	// Standard debugging configuration.
	StandardDebug *StandardDebug `json:"StandardDebug,omitnil,omitempty" name:"StandardDebug"`

	// Just-in-time media processing configuration. The original configuration applies if this field is not specified.
	JITVideoProcess *JITVideoProcess `json:"JITVideoProcess,omitnil,omitempty" name:"JITVideoProcess"`
}

Predefined struct for user

type ModifyZoneSettingResponse 

type ModifyZoneSettingResponse struct {
	*tchttp.BaseResponse
	Response *ModifyZoneSettingResponseParams `json:"Response"`
}

func NewModifyZoneSettingResponse 

func NewModifyZoneSettingResponse() (response *ModifyZoneSettingResponse)

func (*ModifyZoneSettingResponse) FromJsonString 

func (r *ModifyZoneSettingResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyZoneSettingResponse) ToJsonString 

func (r *ModifyZoneSettingResponse) ToJsonString() string

type ModifyZoneSettingResponseParams 

type ModifyZoneSettingResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type ModifyZoneStatusRequest 

type ModifyZoneStatusRequest struct {
	*tchttp.BaseRequest

	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The site status. Values:
	// <li>`false`: Disabled</li>
	// <li>`true`: Enabled</li>
	Paused *bool `json:"Paused,omitnil,omitempty" name:"Paused"`
}

func NewModifyZoneStatusRequest 

func NewModifyZoneStatusRequest() (request *ModifyZoneStatusRequest)

func (*ModifyZoneStatusRequest) FromJsonString 

func (r *ModifyZoneStatusRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyZoneStatusRequest) ToJsonString 

func (r *ModifyZoneStatusRequest) ToJsonString() string

type ModifyZoneStatusRequestParams 

type ModifyZoneStatusRequestParams struct {
	// The site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The site status. Values:
	// <li>`false`: Disabled</li>
	// <li>`true`: Enabled</li>
	Paused *bool `json:"Paused,omitnil,omitempty" name:"Paused"`
}

Predefined struct for user

type ModifyZoneStatusResponse 

type ModifyZoneStatusResponse struct {
	*tchttp.BaseResponse
	Response *ModifyZoneStatusResponseParams `json:"Response"`
}

func NewModifyZoneStatusResponse 

func NewModifyZoneStatusResponse() (response *ModifyZoneStatusResponse)

func (*ModifyZoneStatusResponse) FromJsonString 

func (r *ModifyZoneStatusResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*ModifyZoneStatusResponse) ToJsonString 

func (r *ModifyZoneStatusResponse) ToJsonString() string

type ModifyZoneStatusResponseParams 

type ModifyZoneStatusResponseParams struct {
	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type MutualTLS 

type MutualTLS struct {
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// Mutual authentication certificate list.
	// Note: When using MutualTLS as an input parameter in ModifyHostsCertificate, you only need to provide the CertId of the corresponding certificate. You can check the CertId from the [SSL Certificate List](https://console.cloud.tencent.com/ssl).
	CertInfos []*CertificateInfo `json:"CertInfos,omitnil,omitempty" name:"CertInfos"`
}

type NoCache 

type NoCache struct {
	// Whether to enable no-cache configuration. Valid values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`
}

type NormalAction 

type NormalAction struct {
	// Feature name. For details, see [DescribeRulesSetting](https://intl.cloud.tencent.com/document/product/1552/80618?from_cn_redirect=1) API
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`

	// Parameter
	Parameters []*RuleNormalActionParams `json:"Parameters,omitnil,omitempty" name:"Parameters"`
}

type NsVerification 

type NsVerification struct {
	// The DNS server address assigned to the user when connecting a site to EO via NS. You need to switch the NameServer of the domain name to this address.
	NameServers []*string `json:"NameServers,omitnil,omitempty" name:"NameServers"`
}

type OfflineCache 

type OfflineCache struct {
	// Whether offline cache is enabled. Valid values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`
}

type Origin 

type Origin struct {
	// Primary origin server list
	// Note: This field may return null, indicating that no valid values can be obtained.
	Origins []*string `json:"Origins,omitnil,omitempty" name:"Origins"`

	// The list of backup origin servers.
	// Note: This field may return null, indicating that no valid values can be obtained.
	BackupOrigins []*string `json:"BackupOrigins,omitnil,omitempty" name:"BackupOrigins"`

	// Origin-pull protocol configuration. Values:
	// <li>`http`: Force HTTP for origin-pull.</li>
	// <li>`follow`: Follow protocol.</li>
	// <li>`https`: Force HTTPS for origin-pull.</li>
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	OriginPullProtocol *string `json:"OriginPullProtocol,omitnil,omitempty" name:"OriginPullProtocol"`

	// Whether to allow private access to buckets when `OriginType=cos`. Valid values:
	// <li>`on`: Private access;</li>
	// <li>`off`: Public access.</li>
	// Note: This field may return `null`, indicating that no valid values can be obtained.
	CosPrivateAccess *string `json:"CosPrivateAccess,omitnil,omitempty" name:"CosPrivateAccess"`
}

type OriginDetail 

type OriginDetail struct {
	// Origin server type. Valid values:
	// <li>IP_DOMAIN: IPv4, IPv6, or domain name type origin server;</li>
	// <li>COS: Tencent Cloud COS origin server;</li>
	// <li>AWS_S3: AWS S3 COS origin server;</li>
	// <li>ORIGIN_GROUP: origin server group;</li>
	// <li>VOD: Video on Demand;</li>
	// <li>SPACE: origin server uninstallation, currently only available to the allowlist;</li>
	// <li>LB: load balancing. Currently only available to the allowlist. </li>
	OriginType *string `json:"OriginType,omitnil,omitempty" name:"OriginType"`

	// Origin server address, which varies with the value of OriginType:
	// <li>When OriginType = IP_DOMAIN, this parameter is an IPv4 address, an IPv6 address, or a domain name.</li>
	// <li>When OriginType = COS, this parameter is the access domain name of the COS bucket.</li>
	// <li>When OriginType = AWS_S3, this parameter is the access domain name of the S3 bucket.</li>
	// <li>When OriginType = ORIGIN_GROUP, this parameter is the origin server group ID.</li>
	// <li>When OriginType = VOD, this parameter is the VOD application ID.</li>
	Origin *string `json:"Origin,omitnil,omitempty" name:"Origin"`

	// Secondary origin group ID. This parameter is valid only when OriginType is ORIGIN_GROUP and a secondary origin group is configured.
	BackupOrigin *string `json:"BackupOrigin,omitnil,omitempty" name:"BackupOrigin"`

	// Primary origin group name. This parameter returns a value when OriginType is ORIGIN_GROUP.
	OriginGroupName *string `json:"OriginGroupName,omitnil,omitempty" name:"OriginGroupName"`

	// Secondary origin group name. This parameter is valid only when OriginType is ORIGIN_GROUP and a secondary origin group is configured.
	BackOriginGroupName *string `json:"BackOriginGroupName,omitnil,omitempty" name:"BackOriginGroupName"`

	// Whether access to the private object storage origin server is allowed. This parameter is valid only when the origin server type OriginType is COS or AWS_S3. Valid values:
	// <li>on: Enable private authentication;</li>
	// <li>off: Disable private authentication. </li>
	// If this field is not specified, the default value 'off' will be used.
	PrivateAccess *string `json:"PrivateAccess,omitnil,omitempty" name:"PrivateAccess"`

	// Private authentication parameter. This parameter is valid only when PrivateAccess is on.
	// Note: This field may return null, indicating that no valid values can be obtained.
	PrivateParameters []*PrivateParameter `json:"PrivateParameters,omitnil,omitempty" name:"PrivateParameters"`

	// MO sub-application ID
	//
	// Deprecated: VodeoSubAppId is deprecated.
	VodeoSubAppId *int64 `json:"VodeoSubAppId,omitnil,omitempty" name:"VodeoSubAppId"`

	// MO distribution range. Valid values: <li>All: all</li> <li>Bucket: bucket</li>
	//
	// Deprecated: VodeoDistributionRange is deprecated.
	VodeoDistributionRange *string `json:"VodeoDistributionRange,omitnil,omitempty" name:"VodeoDistributionRange"`

	// MO bucket ID, required when the distribution range (DistributionRange) is bucket (Bucket)
	//
	// Deprecated: VodeoBucketId is deprecated.
	VodeoBucketId *string `json:"VodeoBucketId,omitnil,omitempty" name:"VodeoBucketId"`
}

type OriginGroup 

type OriginGroup struct {
	// The ID of the origin group.
	GroupId *string `json:"GroupId,omitnil,omitempty" name:"GroupId"`

	// The name of the origin group.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// The origin group type. Values:
	// <li>`GENERAL`: General origin group</li>
	// <li>`HTTP`: HTTP-specific origin group</li>
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// Details of the origin record.
	Records []*OriginRecord `json:"Records,omitnil,omitempty" name:"Records"`

	// List of instances referencing this origin group.
	References []*OriginGroupReference `json:"References,omitnil,omitempty" name:"References"`

	// Creation time of the origin group.
	CreateTime *string `json:"CreateTime,omitnil,omitempty" name:"CreateTime"`

	// The update time of the origin group.
	UpdateTime *string `json:"UpdateTime,omitnil,omitempty" name:"UpdateTime"`

	// Origin-pull host header
	// Note: This field may return·null, indicating that no valid values can be obtained.
	HostHeader *string `json:"HostHeader,omitnil,omitempty" name:"HostHeader"`
}

type OriginGroupHealthStatus 

type OriginGroupHealthStatus struct {
	// Origin server group ID.
	OriginGroupID *string `json:"OriginGroupID,omitnil,omitempty" name:"OriginGroupID"`

	// Origin server group name.
	OriginGroupName *string `json:"OriginGroupName,omitnil,omitempty" name:"OriginGroupName"`

	// Origin server group type. Valid values:
	// <li>HTTP: HTTP-specific.</li>
	// <li>GENERAL: general.</li>
	OriginType *string `json:"OriginType,omitnil,omitempty" name:"OriginType"`

	// Priority.
	Priority *string `json:"Priority,omitnil,omitempty" name:"Priority"`

	// Health status of each origin server in an origin server group.
	OriginHealthStatus []*OriginHealthStatus `json:"OriginHealthStatus,omitnil,omitempty" name:"OriginHealthStatus"`
}

type OriginGroupHealthStatusDetail 

type OriginGroupHealthStatusDetail struct {
	// Origin server group ID.
	OriginGroupId *string `json:"OriginGroupId,omitnil,omitempty" name:"OriginGroupId"`

	// The health status of each origin server in an origin server group, which is comprehensively decided based on the results of all detection regions. If more than half of the regions determine that the origin server is unhealthy, the corresponding status is unhealthy; otherwise, it is healthy.
	OriginHealthStatus []*OriginHealthStatus `json:"OriginHealthStatus,omitnil,omitempty" name:"OriginHealthStatus"`

	// Health status of origin servers in each health check region.
	CheckRegionHealthStatus []*CheckRegionHealthStatus `json:"CheckRegionHealthStatus,omitnil,omitempty" name:"CheckRegionHealthStatus"`
}

type OriginGroupInLoadBalancer 

type OriginGroupInLoadBalancer struct {
	// Priority, in the format of "priority_" + "number". The highest priority is "priority_1". Reference values:
	// <li>priority_1: first priority.</li>
	// <li>priority_2: second priority.</li>
	// <li>priority_3: third priority.</li> You can increase numbers for other priorities, up to "priority_10".
	Priority *string `json:"Priority,omitnil,omitempty" name:"Priority"`

	// Origin server group ID.
	OriginGroupId *string `json:"OriginGroupId,omitnil,omitempty" name:"OriginGroupId"`
}

type OriginGroupReference 

type OriginGroupReference struct {
	// Services referencing the origin group. Values:
	// <li>`AccelerationDomain`: Acceleration domain name</li>
	// <li>`RuleEngine`: Rules engine</li>
	// <li>`Loadbalance`: Load balancer</li>
	// <li>`ApplicationProxy`: L4 proxy</li>
	InstanceType *string `json:"InstanceType,omitnil,omitempty" name:"InstanceType"`

	// ID of the instances referencing the origin group
	InstanceId *string `json:"InstanceId,omitnil,omitempty" name:"InstanceId"`

	// Name of the instance referencing the origin group
	InstanceName *string `json:"InstanceName,omitnil,omitempty" name:"InstanceName"`
}

type OriginHealthStatus 

type OriginHealthStatus struct {
	// Origin server.
	Origin *string `json:"Origin,omitnil,omitempty" name:"Origin"`

	// Origin server health status. Valid values:
	// <li>Healthy: healthy.</li>
	// <li>Unhealthy: unhealthy.</li>
	// <li>Undetected: no data detected.</li>
	Healthy *string `json:"Healthy,omitnil,omitempty" name:"Healthy"`
}

type OriginInfo 

type OriginInfo struct {
	// Origin server type, with values:
	// <li>IP_DOMAIN: IPv4, IPv6, or domain name type origin server;</li>
	// <li>COS: Tencent Cloud COS origin server;</li>
	// <li>AWS_S3: AWS S3 origin server;</li>
	// <li>ORIGIN_GROUP: origin server group type origin server;</li>
	//  <li>VOD: Video on Demand;</li>
	// <li>SPACE: origin server uninstallation. Currently only available to the allowlist;</li>
	// <li>LB: load balancing. Currently only available to the allowlist. </li>
	OriginType *string `json:"OriginType,omitnil,omitempty" name:"OriginType"`

	// Origin server address, which varies according to the value of OriginType:
	// <li>When OriginType = IP_DOMAIN, fill in an IPv4 address, an IPv6 address, or a domain name;</li>
	// <li>When OriginType = COS, fill in the access domain name of the COS bucket;</li>
	// <li>When OriginType = AWS_S3, fill in the access domain name of the S3 bucket;</li>
	// <li>When OriginType = ORIGIN_GROUP, fill in the origin server group ID;</li>
	// <li>When OriginType = VOD, fill in the VOD application ID;</li>
	// <li>When OriginType = LB, fill in the Cloud Load Balancer instance ID. This feature is currently only available to the allowlist;</li>
	// <li>When OriginType = SPACE, fill in the origin server uninstallation space ID. This feature is currently only available to the allowlist.</li>
	Origin *string `json:"Origin,omitnil,omitempty" name:"Origin"`

	// The ID of the secondary origin group. This parameter is valid only when OriginType is ORIGIN_GROUP. This field indicates the old version capability, which cannot be configured or modified on the control panel after being called. Please submit a ticket if required.
	BackupOrigin *string `json:"BackupOrigin,omitnil,omitempty" name:"BackupOrigin"`

	// Whether access to the private Cloud Object Storage origin server is allowed. This parameter is valid only when OriginType is COS or AWS_S3. Valid values:
	// <li>on: Enable private authentication;</li>
	// <li>off: Disable private authentication.</li>
	// If it is not specified, the default value is off.
	PrivateAccess *string `json:"PrivateAccess,omitnil,omitempty" name:"PrivateAccess"`

	// Private authentication parameter. This parameter is valid only when PrivateAccess is on.
	PrivateParameters []*PrivateParameter `json:"PrivateParameters,omitnil,omitempty" name:"PrivateParameters"`

	// VODEO sub-application ID. This parameter is required when OriginType is VODEO.
	//
	// Deprecated: VodeoSubAppId is deprecated.
	VodeoSubAppId *int64 `json:"VodeoSubAppId,omitnil,omitempty" name:"VodeoSubAppId"`

	// VOD on EO distribution range. This parameter is required when OriginType = VODEO. The values are:
	// <li>All: all buckets under the current application;</li>
	// <li>Bucket: a specified bucket.</li>
	//
	// Deprecated: VodeoDistributionRange is deprecated.
	VodeoDistributionRange *string `json:"VodeoDistributionRange,omitnil,omitempty" name:"VodeoDistributionRange"`

	// VODEO storage bucket ID. This parameter is required when OriginType is VODEO and VodeoDistributionRange is Bucket.
	//
	// Deprecated: VodeoBucketId is deprecated.
	VodeoBucketId *string `json:"VodeoBucketId,omitnil,omitempty" name:"VodeoBucketId"`
}

type OriginProtectionInfo 

type OriginProtectionInfo struct {
	// ID of the site.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// List of domain names.
	Hosts []*string `json:"Hosts,omitnil,omitempty" name:"Hosts"`

	// List of proxy IDs.
	ProxyIds []*string `json:"ProxyIds,omitnil,omitempty" name:"ProxyIds"`

	// The existing intermediate IPs.
	// Note: This field may return `null`, indicating that no valid values can be obtained.
	CurrentIPWhitelist *IPWhitelist `json:"CurrentIPWhitelist,omitnil,omitempty" name:"CurrentIPWhitelist"`

	// Whether the intermediate IP update is needed for the site. Values:
	// <li>`true`: Update needed;</li>
	// <li>`false`: Update not needed.</li>
	NeedUpdate *bool `json:"NeedUpdate,omitnil,omitempty" name:"NeedUpdate"`

	// Status of the origin protection configuration. Values:
	// <li>`online`: Origin protection is activated;</li>
	// <li>`offline`: Origin protection is disabled.</li>
	// <li>`nonactivate`: Origin protection is not activated. This value is returned only when the feature is not activated before it’s used.</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// Whether origin protection is supported in the plan. Values:
	// <li>`true`: Origin protection supported;</li>
	// <li>`false`: Origin protection not supported.</li>
	PlanSupport *bool `json:"PlanSupport,omitnil,omitempty" name:"PlanSupport"`

	// Differences between the latest and existing intermediate IPs.
	// Note: This field may return `null`, indicating that no valid values can be obtained.
	DiffIPWhitelist *DiffIPWhitelist `json:"DiffIPWhitelist,omitnil,omitempty" name:"DiffIPWhitelist"`
}

type OriginRecord 

type OriginRecord struct {
	// The origin record value, which can be an IPv4/IPv6 address or a domain name.
	Record *string `json:"Record,omitnil,omitempty" name:"Record"`

	// The origin type. Values:
	// <li>`IP_DOMAIN`: IPv4/IPv6 address or domain name</li>
	// <li>`COS`: COS bucket address</li>
	// <li>`AWS_S3`: AWS S3 bucket address
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// The origin record ID.
	RecordId *string `json:"RecordId,omitnil,omitempty" name:"RecordId"`

	// Weight of an origin. Range: 0-100. If it is not specified, a random weight is assigned. If `0` is passed in, there is no traffic scheduled to this origin.
	// Note: This field may return·null, indicating that no valid values can be obtained.
	Weight *uint64 `json:"Weight,omitnil,omitempty" name:"Weight"`

	// Whether to enable private authentication. It is valid when `OriginType=COS/AWS_S3`. Values:
	// <li>`true`: Yes.</li>
	// <li>`false`: No.</li>Default: `false`.
	Private *bool `json:"Private,omitnil,omitempty" name:"Private"`

	// Private authentication parameters. This field is valid when `Private=true`.
	PrivateParameters []*PrivateParameter `json:"PrivateParameters,omitnil,omitempty" name:"PrivateParameters"`
}

type OwnershipVerification 

type OwnershipVerification struct {
	// u200cInformation required for authentication using DNS resolution. It's applicable to sites connected via CNAME. See [Ownership Verification](https://intl.cloud.tencent.com/document/product/1552/70789?from_cn_redirect=1#7af6ecf8-afca-4e35-8811-b5797ed1bde5).
	//
	// Note: This field may return·null, indicating that no valid values can be obtained.
	DnsVerification *DnsVerification `json:"DnsVerification,omitnil,omitempty" name:"DnsVerification"`

	// u200cInformation required for verifying via a file. It's applicable to sites connected via CNAMEs. See [Ownership Verification](https://intl.cloud.tencent.com/document/product/1552/70789?from_cn_redirect=1#7af6ecf8-afca-4e35-8811-b5797ed1bde5).
	//
	// Note: This field may return·null, indicating that no valid values can be obtained.
	FileVerification *FileVerification `json:"FileVerification,omitnil,omitempty" name:"FileVerification"`

	// u200cInformation required for switching DNS servers. It's applicable to sites connected via NSs. For details, see [Modifying DNS Server](https://intl.cloud.tencent.com/document/product/1552/90452?from_cn_redirect=1).
	// Note: This field may return·null, indicating that no valid values can be obtained.
	NsVerification *NsVerification `json:"NsVerification,omitnil,omitempty" name:"NsVerification"`
}

type PartialModule 

type PartialModule struct {
	// The module. Values:
	// <li>`waf`: Managed rules</li>
	Module *string `json:"Module,omitnil,omitempty" name:"Module"`

	// List of managed rule IDs to be skipped.
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	Include []*int64 `json:"Include,omitnil,omitempty" name:"Include"`
}

type PlanInfo 

type PlanInfo struct {
	// Settlement currency. Values:
	// <li>`CNY`: Settled by Chinese RMB;</li>
	// <li>`USD`: Settled by US dollars.</li>
	Currency *string `json:"Currency,omitnil,omitempty" name:"Currency"`

	// Traffic quota of the plan. It includes the traffic for security acceleration, content acceleration and smart acceleration. Unit: byte.
	Flux *uint64 `json:"Flux,omitnil,omitempty" name:"Flux"`

	// Settlement cycle. Values:
	// <li>`y`: Settled by year;</li>
	// <li>`m`: Settled by month;</li>
	// <li>`h`: Settled by hour;</li>
	// <li>`M`: Settled by minute;</li>
	// <li>`s`: Settled by second.</li>
	Frequency *string `json:"Frequency,omitnil,omitempty" name:"Frequency"`

	// The plan option. Values:
	// <li>`sta`: Standard plan that supports content delivery network outside the Chinese mainland.</li>
	// <li>`sta_with_bot`: Standard plan that supports content delivery network outside the Chinese mainland and bot management.</li>
	// <li>`sta_cm`: Standard plan that supports content delivery network inside the Chinese mainland.</li>
	// <li>`sta_cm_with_bot`: Standard plan that supports content delivery network inside the Chinese mainland and bot management.</li>
	// <li>`sta`: Standard plan that supports content delivery network over the globe.</li>
	// <li>`sta_global_with_bot`: Standard plan that supports content delivery network over the globe and bot management.</li>
	// <li>`ent`: Enterprise plan that supports content delivery network outside the Chinese mainland.</li>
	// <li>`ent_with_bot`: Enterprise plan that supports content delivery network outside the Chinese mainland and bot management.</li>
	// <li>`ent_cm`: Enterprise plan that supports content delivery network inside the Chinese mainland.</li>
	// <li>`ent_cm_with_bot`: Enterprise plan that supports content delivery network inside the Chinese mainland and bot management.</li>
	// <li>`ent_global`: Enterprise plan that supports content delivery network over the globe.</li>
	// <li>`ent_global_with_bot`: Enterprise plan that supports content delivery network over the globe and bot management.</li>
	PlanType *string `json:"PlanType,omitnil,omitempty" name:"PlanType"`

	// Plan price (in CNY fen/US cent). The price unit depends on the settlement currency.
	Price *float64 `json:"Price,omitnil,omitempty" name:"Price"`

	// Quota on security acceleration requests
	Request *uint64 `json:"Request,omitnil,omitempty" name:"Request"`

	// Number of sites to be bound to the plan
	SiteNumber *uint64 `json:"SiteNumber,omitnil,omitempty" name:"SiteNumber"`

	// The acceleration region. Values:
	// <li>`mainland`: Chinese mainland</li>
	// <li>`overseas`: Global (Chinese mainland not included)</li>
	// <li>`global`: Global (Chinese mainland included)</li>
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`
}

type PostMaxSize 

type PostMaxSize struct {
	// Whether to enable POST upload limit (default limit: 32 MB). Valid values:
	// <li>`on`: Enable;</li>
	// <li>`off`: Disable.</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// Maximum size. Value range: 1-500 MB.
	// Note: This field may return null, indicating that no valid values can be obtained.
	MaxSize *int64 `json:"MaxSize,omitnil,omitempty" name:"MaxSize"`
}

type PrepaidPlanParam 

type PrepaidPlanParam struct {
	// Prepaid plan duration, unit: month. Valid values: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 24, 36.
	//
	// If this field is not specified, the default value '1' will be used.
	Period *int64 `json:"Period,omitnil,omitempty" name:"Period"`

	// The auto-renewal flag for prepaid plan has the following values:
	// <li> on: Enable auto-renewal;</li>
	// <li> off: Disable auto-renewal. </li>
	// If this field is not specified, the default value 'off' will be used. When auto-renewal is enabled, it defaults to renewing for one month.
	RenewFlag *string `json:"RenewFlag,omitnil,omitempty" name:"RenewFlag"`
}

type PrivateParameter 

type PrivateParameter struct {
	// The name of the private authentication parameter. Valid values:
	// <li>AccessKeyId: Access Key ID for authentication;</li>
	// <li>SecretAccessKey: Secret Access Key for authentication;</li>
	// <li>SignatureVersion: Authentication version, v2 or v4;</li>
	// <li>Region: The region of the storage bucket.</li>
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// The parameter value.
	Value *string `json:"Value,omitnil,omitempty" name:"Value"`
}

type QueryCondition 

type QueryCondition struct {
	// The key of QueryCondition.
	Key *string `json:"Key,omitnil,omitempty" name:"Key"`

	// The conditional operator. Values:
	// <li>`equals`: Equals</li>
	// <li>`notEquals`: Does not equal</li>
	// <li>`include`: Contains</li>
	// <li>`notInclude`: Does not contain</li>
	// <li>`startWith`: Starts with</li>
	// <li>`notStartWith`: Does not start with</li>
	// <li>`endWith`: Ends with</li>
	// <li>`notEndWith`: Does not end with</li>
	Operator *string `json:"Operator,omitnil,omitempty" name:"Operator"`

	// The value of QueryCondition.
	Value []*string `json:"Value,omitnil,omitempty" name:"Value"`
}

type QueryString 

type QueryString struct {
	// Whether to use `QueryString` as part of `CacheKey`. Values:
	// <li>`on`: Yes</li>
	// <li>`off`: No</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// Specifies how to use query strings in the cache key. Values:
	// <li>`includeCustom`: `Include partial query strings.</li>
	// <li>`excludeCustom`: Exclude partial query strings.</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`

	// Array of query strings used/excluded
	// Note: This field may return null, indicating that no valid values can be obtained.
	Value []*string `json:"Value,omitnil,omitempty" name:"Value"`
}

type Quic 

type Quic struct {
	// Whether to enable QUIC. Valid values:
	// <li>`on`: Enable;</li>
	// <li>`off`: Disable.</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`
}

type Quota 

type Quota struct {
	Batch *int64 `json:"Batch,omitnil,omitempty" name:"Batch"`

	// Daily submission quota limit.
	Daily *int64 `json:"Daily,omitnil,omitempty" name:"Daily"`

	// Remaining daily submission quota.
	DailyAvailable *int64 `json:"DailyAvailable,omitnil,omitempty" name:"DailyAvailable"`

	// Type of cache purging/pre-warming. Values:
	// <li>`purge_prefix`: Purge by prefix</li>
	// <li>`purge_url`: Purge by URL</li>
	// <li>`purge_host`: Purge by hostname</li>
	// <li>`purge_all`: Purge all caches</li>
	// <li>`purge_cache_tag`: Purge by cache tag</li><li>`prefetch_url`: Pre-warm by URL</li>
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`
}

type RateLimitConfig 

type RateLimitConfig struct {
	// Switch. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// The settings of the custom rate limiting rule. If it is null, the settings that were last configured will be used.
	RateLimitUserRules []*RateLimitUserRule `json:"RateLimitUserRules,omitnil,omitempty" name:"RateLimitUserRules"`

	// The settings of the rate limiting template. If it is null, the settings that were last configured will be used.
	// Note: This field may return null, indicating that no valid values can be obtained.
	RateLimitTemplate *RateLimitTemplate `json:"RateLimitTemplate,omitnil,omitempty" name:"RateLimitTemplate"`

	// The client filtering settings. If it is null, the settings that were last configured will be used.
	// Note: This field may return null, indicating that no valid values can be obtained.
	RateLimitIntelligence *RateLimitIntelligence `json:"RateLimitIntelligence,omitnil,omitempty" name:"RateLimitIntelligence"`

	// The custom rate limiting rules. If it is `null`, the previous settings is used.
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	RateLimitCustomizes []*RateLimitUserRule `json:"RateLimitCustomizes,omitnil,omitempty" name:"RateLimitCustomizes"`
}

type RateLimitIntelligence 

type RateLimitIntelligence struct {
	// Whether to enable configuration. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// Action to be executed. Values:
	// <li>`monitor`: Observe</li>
	// <li>`alg`: Challenge</li>
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`

	// The rule ID, which is only used as a response parameter.
	RuleId *int64 `json:"RuleId,omitnil,omitempty" name:"RuleId"`
}

type RateLimitTemplate 

type RateLimitTemplate struct {
	// The mode. Values:
	// <li>`sup_loose`: Super loose</li>
	// <li>`loose`: Loose</li>
	// <li>`emergency`: Emergency</li>
	// <li>`normal`: Moderate</li>
	// <li>`strict`: Strict</li>
	// <li>`close`: Off</li>
	Mode *string `json:"Mode,omitnil,omitempty" name:"Mode"`

	// The action. Values:
	// <li>`alg`: JavaScript challenge</li>
	// <li>`monitor`: Observe</li>If it is left empty, the default value `alg` is used.
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`

	// The settings of the rate limiting template. It is only used as an output parameter.
	RateLimitTemplateDetail *RateLimitTemplateDetail `json:"RateLimitTemplateDetail,omitnil,omitempty" name:"RateLimitTemplateDetail"`
}

type RateLimitTemplateDetail 

type RateLimitTemplateDetail struct {
	// Template level name. Valid values:
	// <li>sup_loose: super loose;</li>
	// <li>loose: loose;</li>
	// <li>emergency: emergency;</li>
	// <li>normal: normal;</li>
	// <li>strict: strict;</li>
	// <li>close: disabled, effective only for precise rate limiting.</li>
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	Mode *string `json:"Mode,omitnil,omitempty" name:"Mode"`

	// Unique ID.
	ID *int64 `json:"ID,omitnil,omitempty" name:"ID"`

	// Template action. Valid values:
	// <li>alg: JavaScript challenge;</li>
	// <li>monitor: observation.</li>
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`

	// Penalty duration, in seconds. Value range: 0-2 days.
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	PunishTime *int64 `json:"PunishTime,omitnil,omitempty" name:"PunishTime"`

	// Statistical threshold, in times. Value range: 0-4294967294.
	Threshold *int64 `json:"Threshold,omitnil,omitempty" name:"Threshold"`

	// Statistical cycle. Value range: 0-120 seconds.
	Period *int64 `json:"Period,omitnil,omitempty" name:"Period"`
}

type RateLimitUserRule 

type RateLimitUserRule struct {
	// The request threshold. Value range: 0-4294967294.
	Threshold *int64 `json:"Threshold,omitnil,omitempty" name:"Threshold"`

	// The statistical period. The value can be 10, 20, 30, 40, 50, or 60 seconds.
	Period *int64 `json:"Period,omitnil,omitempty" name:"Period"`

	// The rule name, which consists of only letters, digits, and underscores and cannot start with an underscore.
	RuleName *string `json:"RuleName,omitnil,omitempty" name:"RuleName"`

	// Action. Values:<li>`monitor`: Observe;</li><li>`drop`: Block;</li><li>`redirect`: Redirect;</li><li>`page`: Return a specific page;</li><li>`alg`: JavaScript challenge. </li>
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`

	// The amount of time taken to perform the action. Value range: 0 seconds - 2 days.
	PunishTime *int64 `json:"PunishTime,omitnil,omitempty" name:"PunishTime"`

	// The time unit. Values:
	// <li>`second`: Second</li>
	// <li>`minutes`: Minute</li>
	// <li>`hour`: Hour</li>
	PunishTimeUnit *string `json:"PunishTimeUnit,omitnil,omitempty" name:"PunishTimeUnit"`

	// The rule status. Values:
	// <li>`on`: Enabled</li>
	// <li>`off`: Disabled</li>Default value: `on`
	RuleStatus *string `json:"RuleStatus,omitnil,omitempty" name:"RuleStatus"`

	// The rule details.
	AclConditions []*AclCondition `json:"AclConditions,omitnil,omitempty" name:"AclConditions"`

	// The rule weight. Value range: 0-100.
	RulePriority *int64 `json:"RulePriority,omitnil,omitempty" name:"RulePriority"`

	// Rule ID, which is only used as an output parameter.
	RuleID *int64 `json:"RuleID,omitnil,omitempty" name:"RuleID"`

	// The filter. Values:
	// <li>`sip`: Client IP</li>
	// This parameter is left empty by default.
	FreqFields []*string `json:"FreqFields,omitnil,omitempty" name:"FreqFields"`

	// Update time. It is only used as a response parameter, and defaults to the current time.
	UpdateTime *string `json:"UpdateTime,omitnil,omitempty" name:"UpdateTime"`

	// Query scope. Values:
	// <li>`source_to_eo`: (Response) Traffic going from the origin to EdgeOne.</li>
	// <li>`client_to_eo`: (Request) Traffic going from the client to EdgeOne.</li>
	// Default: `source_to_eo`.
	FreqScope []*string `json:"FreqScope,omitnil,omitempty" name:"FreqScope"`

	// Name of the custom return page. It's required when `Action=page`.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// ID of custom response. The ID can be obtained via the `DescribeCustomErrorPages` API. It's required when `Action=page`.
	CustomResponseId *string `json:"CustomResponseId,omitnil,omitempty" name:"CustomResponseId"`

	// The response code to trigger the return page. It's required when `Action=page`. Value: 100-600. 3xx response codes are not supported. Default value: 567.
	ResponseCode *int64 `json:"ResponseCode,omitnil,omitempty" name:"ResponseCode"`

	// The redirection URL. It's required when `Action=redirect`.
	RedirectUrl *string `json:"RedirectUrl,omitnil,omitempty" name:"RedirectUrl"`
}

type RealtimeLogDeliveryTask 

type RealtimeLogDeliveryTask struct {
	// ID of a real-time log shipping task.
	TaskId *string `json:"TaskId,omitnil,omitempty" name:"TaskId"`

	// Name of a real-time log shipping task.
	TaskName *string `json:"TaskName,omitnil,omitempty" name:"TaskName"`

	// Status of a real-time log shipping task. Valid values: <li>enabled: enabled;</li><li>disabled: disabled;</li><li>deleted: deleted abnormally. Check whether the destination log set/log topic of Tencent Cloud CLS has been deleted.</li>
	DeliveryStatus *string `json:"DeliveryStatus,omitnil,omitempty" name:"DeliveryStatus"`

	// Type of a real-time log shipping task. Valid values:<li>cls: push to Tencent Cloud CLS;</li><li>custom_endpoint: push to a custom HTTP(S) address;</li><li>s3: push to an AWS S3-compatible bucket address.</li>
	TaskType *string `json:"TaskType,omitnil,omitempty" name:"TaskType"`

	// List of entities (L7 domain names or L4 proxy instances) corresponding to a real-time log shipping task. Valid value examples: <li>L7 domain name: domain.example.com;</li><li>L4 proxy instance: sid-2s69eb5wcms7.</li>
	EntityList []*string `json:"EntityList,omitnil,omitempty" name:"EntityList"`

	// Data shipping type. Valid values: <li>domain: site acceleration logs;</li><li>application: L4 proxy logs;</li><li>web-rateLiming: rate limiting and CC attack defense logs;</li><li>web-attack: managed rule logs;</li><li>web-rule: custom rule logs;</li><li>web-bot: Bot management logs.</li>
	LogType *string `json:"LogType,omitnil,omitempty" name:"LogType"`

	// Data shipping area. Valid values:<li>mainland: within the Chinese mainland;</li><li>overseas: global (excluding the Chinese mainland).</li>
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// List of predefined fields for shipping.
	Fields []*string `json:"Fields,omitnil,omitempty" name:"Fields"`

	// List of custom fields for shipping.
	CustomFields []*CustomField `json:"CustomFields,omitnil,omitempty" name:"CustomFields"`

	// Filter criteria of log shipping.
	DeliveryConditions []*DeliveryCondition `json:"DeliveryConditions,omitnil,omitempty" name:"DeliveryConditions"`

	// Sampling ratio in permille. Value range: 1-1000. For example, 605 indicates a sampling ratio of 60.5%.
	Sample *uint64 `json:"Sample,omitnil,omitempty" name:"Sample"`

	// Output format for log delivery. When the output parameter is null, the default format is used, which works as follows:
	// <li>When TaskType is 'custom_endpoint', the default format is an array of JSON objects, with each JSON object representing a log entry;</li>
	// <li>When TaskType is 's3', the default format is JSON Lines. </li>
	// Note: This field may return 'null', which indicates a failure to obtain a valid value.
	LogFormat *LogFormat `json:"LogFormat,omitnil,omitempty" name:"LogFormat"`

	// Configuration information of the CLS.
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	CLS *CLSTopic `json:"CLS,omitnil,omitempty" name:"CLS"`

	// Configuration information of the custom HTTP service.
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	CustomEndpoint *CustomEndpoint `json:"CustomEndpoint,omitnil,omitempty" name:"CustomEndpoint"`

	// Configuration information of the AWS S3-compatible bucket.
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	S3 *S3 `json:"S3,omitnil,omitempty" name:"S3"`

	// Creation time.
	CreateTime *string `json:"CreateTime,omitnil,omitempty" name:"CreateTime"`

	// Update time.
	UpdateTime *string `json:"UpdateTime,omitnil,omitempty" name:"UpdateTime"`
}

type RenewFlag 

type RenewFlag struct {
	// The auto-renewal flag for prepaid plan has the following values:
	// <li> on: Enable auto-renewal;</li>
	// <li> off: Disable auto-renewal. </li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`
}

type RenewPlanRequest 

type RenewPlanRequest struct {
	*tchttp.BaseRequest

	// Plan ID, formatted as edgeone-2unuvzjmmn2q.
	PlanId *string `json:"PlanId,omitnil,omitempty" name:"PlanId"`

	// Renewal plan duration, unit: month. Valid values: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 24, 36.
	Period *int64 `json:"Period,omitnil,omitempty" name:"Period"`

	// Whether to automatically use a voucher. Valid values: <li>true: Yes;</li><li>false: No. </li> If this field is not specified, the default value 'false' will be used.
	AutoUseVoucher *string `json:"AutoUseVoucher,omitnil,omitempty" name:"AutoUseVoucher"`
}

func NewRenewPlanRequest 

func NewRenewPlanRequest() (request *RenewPlanRequest)

func (*RenewPlanRequest) FromJsonString 

func (r *RenewPlanRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*RenewPlanRequest) ToJsonString 

func (r *RenewPlanRequest) ToJsonString() string

type RenewPlanRequestParams 

type RenewPlanRequestParams struct {
	// Plan ID, formatted as edgeone-2unuvzjmmn2q.
	PlanId *string `json:"PlanId,omitnil,omitempty" name:"PlanId"`

	// Renewal plan duration, unit: month. Valid values: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 24, 36.
	Period *int64 `json:"Period,omitnil,omitempty" name:"Period"`

	// Whether to automatically use a voucher. Valid values: <li>true: Yes;</li><li>false: No. </li> If this field is not specified, the default value 'false' will be used.
	AutoUseVoucher *string `json:"AutoUseVoucher,omitnil,omitempty" name:"AutoUseVoucher"`
}

Predefined struct for user

type RenewPlanResponse 

type RenewPlanResponse struct {
	*tchttp.BaseResponse
	Response *RenewPlanResponseParams `json:"Response"`
}

func NewRenewPlanResponse 

func NewRenewPlanResponse() (response *RenewPlanResponse)

func (*RenewPlanResponse) FromJsonString 

func (r *RenewPlanResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*RenewPlanResponse) ToJsonString 

func (r *RenewPlanResponse) ToJsonString() string

type RenewPlanResponseParams 

type RenewPlanResponseParams struct {
	// Order number.
	DealName *string `json:"DealName,omitnil,omitempty" name:"DealName"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type Resource 

type Resource struct {
	// The resource ID.
	Id *string `json:"Id,omitnil,omitempty" name:"Id"`

	// Billing mode
	// `0`: Pay-as-you-go
	PayMode *int64 `json:"PayMode,omitnil,omitempty" name:"PayMode"`

	// The creation time.
	CreateTime *string `json:"CreateTime,omitnil,omitempty" name:"CreateTime"`

	// The effective time.
	EnableTime *string `json:"EnableTime,omitnil,omitempty" name:"EnableTime"`

	// The expiration time.
	ExpireTime *string `json:"ExpireTime,omitnil,omitempty" name:"ExpireTime"`

	// The plan status. Values:
	// <li>`normal`: Normal</li>
	// <li>`isolated`: Isolated</li>
	// <li>`destroyed`: Terminated</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// Pricing query parameter
	Sv []*Sv `json:"Sv,omitnil,omitempty" name:"Sv"`

	// Whether to enable auto-renewal. Values:
	// <li>`0`: Default status.</li>
	// <li>`1`: Enable auto-renewal.</li>
	// <li>`2`: Disable auto-renewal.</li>
	AutoRenewFlag *int64 `json:"AutoRenewFlag,omitnil,omitempty" name:"AutoRenewFlag"`

	// ID of the resource associated with the plan.
	PlanId *string `json:"PlanId,omitnil,omitempty" name:"PlanId"`

	// Applicable area. Values:
	// <li>`mainland`: Chinese mainland</li>
	// <li>`overseas`: Regions outside the Chinese mainland</li>
	// <li>`global`: Global</li>
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// The resource type. Values:
	// <li>`plan`: Plan resources</li>
	// <li>`pay-as-you-go`: Pay-as-you-go resources </li>
	// <li>`value-added`: Value-added resources </li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	Group *string `json:"Group,omitnil,omitempty" name:"Group"`

	// The sites that are associated with the current resources.
	// Note: This field may return null, indicating that no valid values can be obtained.
	ZoneNumber *int64 `json:"ZoneNumber,omitnil,omitempty" name:"ZoneNumber"`

	// Resource tag type. Valid values:
	// <li>vodeo: vodeo resource.</li>
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`
}

type RewriteAction 

type RewriteAction struct {
	// Feature name. For details, see [DescribeRulesSetting](https://intl.cloud.tencent.com/document/product/1552/80618?from_cn_redirect=1) API
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`

	// Parameter
	Parameters []*RuleRewriteActionParams `json:"Parameters,omitnil,omitempty" name:"Parameters"`
}

type Rule 

type Rule struct {
	// Judgment condition for executing the feature.
	// Note: The feature can be executed if any condition in the array is met.
	Conditions []*RuleAndConditions `json:"Conditions,omitnil,omitempty" name:"Conditions"`

	// Executed feature. Note: Actions and SubRules cannot be both empty.
	Actions []*Action `json:"Actions,omitnil,omitempty" name:"Actions"`

	// Nested rule. Note: SubRules and Actions cannot be both empty.
	SubRules []*SubRuleItem `json:"SubRules,omitnil,omitempty" name:"SubRules"`
}

type RuleAndConditions 

type RuleAndConditions struct {
	// Rule engine condition. This condition will be considered met if all items in the array are met.
	Conditions []*RuleCondition `json:"Conditions,omitnil,omitempty" name:"Conditions"`
}

type RuleChoicePropertiesItem 

type RuleChoicePropertiesItem struct {
	// The parameter name.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// The parameter value type.
	// <li>CHOICE: The parameter value can be selected only from `Values`.</li>
	// <li>TOGGLE: The parameter value is of switch type and can be selected from `ChoicesValue`.</li>
	// <li>CUSTOM_NUM: The parameter value is a custom integer.</li>
	// <li>CUSTOM_STRING: The parameter value is a custom string.</li>
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// Valid parameter values.
	// Note: If `Type` is `CUSTOM_NUM` or `CUSTOM_STRING`, this parameter will be an empty array.
	ChoicesValue []*string `json:"ChoicesValue,omitnil,omitempty" name:"ChoicesValue"`

	// Minimum value. If both `Min` and `Max` are set to `0`, this parameter does not take effect.
	Min *int64 `json:"Min,omitnil,omitempty" name:"Min"`

	// Maximum value. If both `Min` and `Max` are set to `0`, this parameter does not take effect.
	Max *int64 `json:"Max,omitnil,omitempty" name:"Max"`

	// Whether multiple values can be selected or entered.
	IsMultiple *bool `json:"IsMultiple,omitnil,omitempty" name:"IsMultiple"`

	// Whether the parameter can be left empty.
	IsAllowEmpty *bool `json:"IsAllowEmpty,omitnil,omitempty" name:"IsAllowEmpty"`

	// Special parameter.
	// <li>NULL: Select `NormalAction` for `RuleAction`. </li>
	// <li>If the member parameter `Id` is `Action`, select `RewirteAction` for `RuleAction`.</li>
	// <li>If the member parameter `Id` is `StatusCode`, select `CodeAction` for `RuleAction`.</li>
	ExtraParameter *RuleExtraParameter `json:"ExtraParameter,omitnil,omitempty" name:"ExtraParameter"`
}

type RuleCodeActionParams 

type RuleCodeActionParams struct {
	// The status code.
	StatusCode *int64 `json:"StatusCode,omitnil,omitempty" name:"StatusCode"`

	// The parameter name. For details, see [DescribeRulesSetting](https://intl.cloud.tencent.com/document/product/1552/80618?from_cn_redirect=1).
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// The parameter value.
	Values []*string `json:"Values,omitnil,omitempty" name:"Values"`
}

type RuleCondition 

type RuleCondition struct {
	// Operator. Valid values:
	// <li>`equals`: Equals</li>
	// <li>`notEquals`: Does not equal</li>
	// <li>`exist`: Exists</li>
	// <li>`notexist`: Does not exist</li>
	Operator *string `json:"Operator,omitnil,omitempty" name:"Operator"`

	// Match type. Valid values: <li> filename: File name; </li> <li> extension: File extension; </li> <li> host: Host name; </li> <li> full_url: The complete URL path under the current site, which must include the HTTP protocol, host, and path; </li> <li> url: Request for the URL path under the current site; </li><li> client_country: Client country/region;</li> <li> query_string: The query string of the URL requested under the current site; </li> <li> request_header: HTTP request header; </li><li> client_ip: Client IP address. </li>
	Target *string `json:"Target,omitnil,omitempty" name:"Target"`

	// The parameter values for match types. It is allowed to pass an empty array only when the match type is query_string or request_header and the operator value is Exist or Does Not Exist. The corresponding match types include:
	// <li> File extension: Extensions like jpg, txt, etc.;</li>
	// <li> File name: For example, foo in foo.jpg;</li>
	// <li> All: All requests for domain names under the site; </li>
	// <li> HOST: The host under the current site, for example, www.maxx55.com;</li>
	// <li> URL Path: Request for the URL path under the current site, for example, /example;</li>
	// <li> URL Full: The complete URL request under the current site, which must include the HTTP protocol, host, and path, for example, https://www.maxx55.cn/example;</li>
	// <li> Client country/region: Country/region codes compliant with the ISO3166 standard;</li>
	// <li> Query string: The parameter values in the query string of the URL requested under the current site, for example, cn and 1 in lang=cn&version=1; </li>
	// <li> HTTP request header: The value of the HTTP request header field, for example, zh-CN,zh;q=0.9 in Accept-Language:zh-CN,zh;q=0.9; </li>
	// <li> Client IP: The client IP address carried by the current request, supporting IPv4, IPv6, and an IP range. </li>
	Values []*string `json:"Values,omitnil,omitempty" name:"Values"`

	// Whether the parameter value is case insensitive. Default value: false.
	IgnoreCase *bool `json:"IgnoreCase,omitnil,omitempty" name:"IgnoreCase"`

	// The parameter name of the match type. This field is required only when `Target=query_string/request_header`.
	// <li>`query_string`: Name of the query string, such as "lang" and "version" in "lang=cn&version=1".</li>
	// <li>`request_header`: Name of the HTTP request header, such as "Accept-Language" in the "Accept-Language:zh-CN,zh;q=0.9" header.</li>
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// Whether the parameter name is case insensitive. Default value: `false`.
	// Note: This field may return null, indicating that no valid values can be obtained.
	//
	// Deprecated: IgnoreNameCase is deprecated.
	IgnoreNameCase *bool `json:"IgnoreNameCase,omitnil,omitempty" name:"IgnoreNameCase"`
}

type RuleExtraParameter 

type RuleExtraParameter struct {
	// Parameter name. Valid values:
	// <li>`Action`: Required parameter for HTTP header modification when `RewirteAction` is selected for `RuleAction`.</li>
	// <li>`StatusCode`: Required parameter for the status code feature when `CodeAction` is selected for `RuleAction`.</li>
	Id *string `json:"Id,omitnil,omitempty" name:"Id"`

	// Parameter value type.
	// <li>`CHOICE`: The parameter value can be selected only from `Values`.</li>
	// <li>`CUSTOM_NUM`: The parameter value is a custom integer.</li>
	// <li>`CUSTOM_STRING`: The parameter value is a custom string.</li>
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// Valid values.
	// Note: If the value of `Id` is `StatusCode`, values in the array are all integer values. When entering a parameter value, enter the integer value of the string.
	Choices []*string `json:"Choices,omitnil,omitempty" name:"Choices"`
}

type RuleItem 

type RuleItem struct {
	// The rule ID.
	RuleId *string `json:"RuleId,omitnil,omitempty" name:"RuleId"`

	// The rule name. It is a string that can contain 1–255 characters.
	RuleName *string `json:"RuleName,omitnil,omitempty" name:"RuleName"`

	// Rule status. Values:
	// <li>`enable`: Enabled</li>
	// <li>`disable`: Disabled</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// The rule content.
	Rules []*Rule `json:"Rules,omitnil,omitempty" name:"Rules"`

	// The rule priority. The greater the value, the higher the priority. The minimum value is `1`.
	RulePriority *int64 `json:"RulePriority,omitnil,omitempty" name:"RulePriority"`

	// Tag of the rule.
	Tags []*string `json:"Tags,omitnil,omitempty" name:"Tags"`
}

type RuleNormalActionParams 

type RuleNormalActionParams struct {
	// The parameter name. For details, see [DescribeRulesSetting](https://intl.cloud.tencent.com/document/product/1552/80618?from_cn_redirect=1).
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// The parameter value.
	Values []*string `json:"Values,omitnil,omitempty" name:"Values"`
}

type RuleRewriteActionParams 

type RuleRewriteActionParams struct {
	// Feature parameter name. For details, see [DescribeRulesSetting](https://intl.cloud.tencent.com/document/product/1552/80618?from_cn_redirect=1).
	// <li>`add`: Add the HTTP header.</li>
	// <li>`set`: Rewrite the HTTP header.</li>
	// <li>`del`: Delete the HTTP header.</li>
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`

	// Parameter name
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// Parameter value
	Values []*string `json:"Values,omitnil,omitempty" name:"Values"`
}

type RulesProperties 

type RulesProperties struct {
	// Parameter name.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// Minimum value. If both `Min` and `Max` are set to `0`, this parameter does not take effect.
	Min *int64 `json:"Min,omitnil,omitempty" name:"Min"`

	// Valid parameter values.
	// Note: If `Type` is `CUSTOM_NUM` or `CUSTOM_STRING`, this parameter will be an empty array.
	ChoicesValue []*string `json:"ChoicesValue,omitnil,omitempty" name:"ChoicesValue"`

	// The parameter value type.
	// <li>`CHOICE`: `If Type=CHOICE`, choose a value in `ChoiceValue`.</li>
	// <li>`TOGGLE`: If `Type=TOGGLE`, choose `on` or `off` from `ChoicesValue`.</li>
	// <li>`OBJECT`: Specify an object. If this is specified, `ChoiceProperties` includes attributes of the specified object. See [Example 2. Create a rule with Type=OBJECT](https://intl.cloud.tencent.com/document/product/1552/80622?from_cn_redirect=1#.E7.A4.BA.E4.BE.8B2-.E5.8F.82.E6.95.B0.E4.B8.BA-OBJECT-.E7.B1.BB.E5.9E.8B.E7.9A.84.E5.88.9B.E5.BB.BA)</li>
	// <li>`CUSTOM_NUM`: (Integer) Custom value.</li>
	// <li>`CUSTOM_STRING`: (String) Custom value.</li>
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// Maximum value. If both `Min` and `Max` are set to `0`, this parameter does not take effect.
	Max *int64 `json:"Max,omitnil,omitempty" name:"Max"`

	// Whether multiple values can be selected or entered.
	IsMultiple *bool `json:"IsMultiple,omitnil,omitempty" name:"IsMultiple"`

	// Whether the parameter can be left empty.
	IsAllowEmpty *bool `json:"IsAllowEmpty,omitnil,omitempty" name:"IsAllowEmpty"`

	// Associated configuration parameters of this parameter, which are required for API call.
	// Note: This parameter will be an empty array if no special parameters are added as optional parameters.
	ChoiceProperties []*RuleChoicePropertiesItem `json:"ChoiceProperties,omitnil,omitempty" name:"ChoiceProperties"`

	// <li>NULL: No special parameters when `NormalAction` is selected for `RuleAction`.</li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	ExtraParameter *RuleExtraParameter `json:"ExtraParameter,omitnil,omitempty" name:"ExtraParameter"`
}

type RulesSettingAction 

type RulesSettingAction struct {
	// Feature name. Valid values:
	// <li>Access URL rewrite (`AccessUrlRedirect`).</li>
	// <li>Origin-pull URL rewrite (`UpstreamUrlRedirect`).</li>
	// <li>Custom error page
	// (`ErrorPage`).</li>
	// <li>QUIC (`QUIC`).</li>
	// <li>WebSocket (`WebSocket`).</li>
	// <li>Video dragging (`VideoSeek`).</li>
	// <li>Token authentication (`Authentication`).</li>
	// <li>`CacheKey`: Custom cache key.</li>
	// <li>`Cache`: Node cache TTL.</li>
	// <li>`MaxAge`: Browser cache TTL.</li>
	// <li>`OfflineCache`: Offline cache.</li>
	// <li>`SmartRouting`: Smart acceleration.</li>
	// <li>`RangeOriginPull`: Range GETs.</li>
	// <li>`UpstreamHttp2`: HTTP/2 forwarding.</li>
	// <li>`HostHeader`: Host header rewrite.</li>
	// <li>`ForceRedirect`: Force HTTPS.</li>
	// <li>`OriginPullProtocol`: Origin-pull HTTPS.</li>
	// <li>`CachePrefresh`: Cache prefresh.</li>
	// <li>`Compression`: Smart compression.</li>
	// <li>`RequestHeader`: HTTP request header modification.</li>
	// <li>HTTP response header modification (`ResponseHeader`).</li>
	// <li>Status code cache TTL (`StatusCodeCache`).</li>
	// <li>`Hsts`.</li>
	// <li>`ClientIpHeader`.</li>
	// <li>`TlsVersion`.</li>
	// <li>`OcspStapling`.</li>
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`

	// Parameter information
	Properties []*RulesProperties `json:"Properties,omitnil,omitempty" name:"Properties"`
}

type S3 

type S3 struct {
	// The URL without bucket name or path, for example: `https://storage.googleapis.com`, `https://s3.ap-northeast-2.amazonaws.com`, and `https://cos.ap-nanjing.myqcloud.com`.
	Endpoint *string `json:"Endpoint,omitnil,omitempty" name:"Endpoint"`

	// The region where the bucket is located, for example: `ap-northeast-2`.
	Region *string `json:"Region,omitnil,omitempty" name:"Region"`

	// The bucket name and log storage directory, for example: `your_bucket_name/EO-logs/`. If the directory does not exist in the bucket, it will be created automatically.
	Bucket *string `json:"Bucket,omitnil,omitempty" name:"Bucket"`

	// The Access Key ID used to access the bucket.
	AccessId *string `json:"AccessId,omitnil,omitempty" name:"AccessId"`

	// The secret key used to access the bucket.
	AccessKey *string `json:"AccessKey,omitnil,omitempty" name:"AccessKey"`

	// The data compress type. Valid values:<li>gzip: gzip compression.</li>If this field is not filled in, compression is disabled.
	CompressType *string `json:"CompressType,omitnil,omitempty" name:"CompressType"`
}

type SecEntry 

type SecEntry struct {
	// The query dimension value.
	Key *string `json:"Key,omitnil,omitempty" name:"Key"`

	// The details.
	Value []*SecEntryValue `json:"Value,omitnil,omitempty" name:"Value"`
}

type SecEntryValue 

type SecEntryValue struct {
	// The metric name.
	Metric *string `json:"Metric,omitnil,omitempty" name:"Metric"`

	// The time-series data details.
	Detail []*TimingDataItem `json:"Detail,omitnil,omitempty" name:"Detail"`

	// The maximum value.
	Max *int64 `json:"Max,omitnil,omitempty" name:"Max"`

	// The average value.
	Avg *float64 `json:"Avg,omitnil,omitempty" name:"Avg"`

	// Sum
	Sum *float64 `json:"Sum,omitnil,omitempty" name:"Sum"`
}

type SecurityConfig 

type SecurityConfig struct {
	// Managed rule. If the parameter is null or not filled, the configuration last set will be used by default.
	// Note: This field may return null, indicating that no valid value can be obtained.
	WafConfig *WafConfig `json:"WafConfig,omitnil,omitempty" name:"WafConfig"`

	// Rate limiting. If the parameter is null or not filled, the configuration last set will be used by default.
	// Note: This field may return null, indicating that no valid value can be obtained.
	RateLimitConfig *RateLimitConfig `json:"RateLimitConfig,omitnil,omitempty" name:"RateLimitConfig"`

	// Custom rule. If the parameter is null or not filled, the configuration last set will be used by default.
	// Note: This field may return null, indicating that no valid value can be obtained.
	AclConfig *AclConfig `json:"AclConfig,omitnil,omitempty" name:"AclConfig"`

	// Bot configuration. If the parameter is null or not filled, the configuration last set will be used by default.
	// Note: This field may return null, indicating that no valid value can be obtained.
	BotConfig *BotConfig `json:"BotConfig,omitnil,omitempty" name:"BotConfig"`

	// Switch setting of the 7-layer protection. If the parameter is null or not filled, the configuration last set will be used by default.Note: This field may return null, indicating that no valid value can be obtained.
	SwitchConfig *SwitchConfig `json:"SwitchConfig,omitnil,omitempty" name:"SwitchConfig"`

	// Basic access control. If the parameter is null or not filled, the configuration last set will be used by default.
	// Note: This field may return null, indicating that no valid value can be obtained.
	IpTableConfig *IpTableConfig `json:"IpTableConfig,omitnil,omitempty" name:"IpTableConfig"`

	// Exception rule configuration. If the parameter is null or not filled, the configuration last set will be used by default.Note: This field may return null, indicating that no valid value can be obtained.
	ExceptConfig *ExceptConfig `json:"ExceptConfig,omitnil,omitempty" name:"ExceptConfig"`

	// Custom block page settings. If the parameter is null or not filled, the configuration last set will be used by default.Note: This field may return null, indicating that no valid value can be obtained.
	DropPageConfig *DropPageConfig `json:"DropPageConfig,omitnil,omitempty" name:"DropPageConfig"`

	// Security template settings
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	TemplateConfig *TemplateConfig `json:"TemplateConfig,omitnil,omitempty" name:"TemplateConfig"`

	// Settings for slow attack defense. If the parameter is null or not filled, the configuration last set will be used by default.Note: This field may return null, indicating that no valid value can be obtained.
	SlowPostConfig *SlowPostConfig `json:"SlowPostConfig,omitnil,omitempty" name:"SlowPostConfig"`
}

type SecurityTemplateBinding 

type SecurityTemplateBinding struct {
	// template ID
	TemplateId *string `json:"TemplateId,omitnil,omitempty" name:"TemplateId"`

	// Binding status of the template.
	TemplateScope []*TemplateScope `json:"TemplateScope,omitnil,omitempty" name:"TemplateScope"`
}

type SecurityType 

type SecurityType struct {
	// Whether to enable the security type setting. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`
}

type ServerCertInfo 

type ServerCertInfo struct {
	// Server certificate ID, which originates from the SSL side. You can check the CertId from the [SSL Certificate List](https://console.cloud.tencent.com/ssl).
	//
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	CertId *string `json:"CertId,omitnil,omitempty" name:"CertId"`

	// Alias of the certificate.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Alias *string `json:"Alias,omitnil,omitempty" name:"Alias"`

	// Type of the certificate. Values:
	// u200c<li>`default`: Default certificate</li>
	// u200c<li>`upload`: Custom certificate</li>
	// u200c<li>`managed`: Tencent Cloud-managed certificate</li>
	// Note: This field may return·null, indicating that no valid values can be obtained.
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// Time when the certificate expires.
	// Note: This field may return null, indicating that no valid values can be obtained.
	ExpireTime *string `json:"ExpireTime,omitnil,omitempty" name:"ExpireTime"`

	// Time when the certificate is deployed.
	// Note: This field may return null, indicating that no valid values can be obtained.
	DeployTime *string `json:"DeployTime,omitnil,omitempty" name:"DeployTime"`

	// Signature algorithm.
	// Note: This field may return null, indicating that no valid values can be obtained.
	SignAlgo *string `json:"SignAlgo,omitnil,omitempty" name:"SignAlgo"`

	// Domain name of the certificate.
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	CommonName *string `json:"CommonName,omitnil,omitempty" name:"CommonName"`
}

type SkipCondition 

type SkipCondition struct {
	// The field type. Values:
	// <li>`header_fields`: HTTP request header</li>
	// <li>`cookie`: HTTP request cookie</li>
	// <li>`query_string`: Query string in the HTTP request URL</li>
	// <li>`uri`: HTTP request URI</li>
	// <li>`body_raw`: HTTP request body</li>
	// <li>`body_json`: JSON HTTP request body</li>
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// The specific field. Values:
	// <li>`args`: Query parameter in the URI, such as "?name1=jack&age=12"</li>
	// <li>`path`: Partial path in the URI, such as "/path/to/resource.jpg"</li>
	// <li>`full`: Full path in the URI, such as "example.com/path/to/resource.jpg?name1=jack&age=12"</li>
	// <li>`upload_filename`: File path segment</li>
	// <li>`keys`: All keys</li>
	// <li>`values`: Values of all keys</li>
	// <li>`key_value`: Key and its value</li>
	Selector *string `json:"Selector,omitnil,omitempty" name:"Selector"`

	// The match method used to match the key. Values:
	// <li>`equal`: Exact match</li>
	// <li>`wildcard`: Wildcard match (only asterisks)</li>
	MatchFromType *string `json:"MatchFromType,omitnil,omitempty" name:"MatchFromType"`

	// The value that matches the key.
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	MatchFrom []*string `json:"MatchFrom,omitnil,omitempty" name:"MatchFrom"`

	// The match method used to match the content.
	// <li>`equal`: Exact match</li>
	// <li>`wildcard`: Wildcard match (only asterisks)</li>
	MatchContentType *string `json:"MatchContentType,omitnil,omitempty" name:"MatchContentType"`

	// The value that matches the content.
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	MatchContent []*string `json:"MatchContent,omitnil,omitempty" name:"MatchContent"`
}

type SlowPostConfig 

type SlowPostConfig struct {
	// Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// Detect slow attacks by the transfer period of the first 8 KB of requests
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	FirstPartConfig *FirstPartConfig `json:"FirstPartConfig,omitnil,omitempty" name:"FirstPartConfig"`

	// Detect slow attacks by the data rate of the main body (excluding the first 8 KB) of requests
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	SlowRateConfig *SlowRateConfig `json:"SlowRateConfig,omitnil,omitempty" name:"SlowRateConfig"`

	// The action to taken when a slow attack is detected. Values:
	// <li>`monitor`: Observe</li>
	// <li>`drop`: Block the request</li>
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	Action *string `json:"Action,omitnil,omitempty" name:"Action"`

	// ID of the rule
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	RuleId *uint64 `json:"RuleId,omitnil,omitempty" name:"RuleId"`
}

type SlowRateConfig 

type SlowRateConfig struct {
	// Switch. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// The sampling interval in seconds. In this way, the first 8 KB of the request is ignored. The rest of data is separated in to multiple parts according to this interval for slow attack measurement.
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	Interval *uint64 `json:"Interval,omitnil,omitempty" name:"Interval"`

	// The transfer rate threshold in bps. When the transfer rate of a sample is lower than the threshold, it’s considered a slow attack and handled according to the specified `Action`.
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	Threshold *uint64 `json:"Threshold,omitnil,omitempty" name:"Threshold"`
}

type SmartRouting 

type SmartRouting struct {
	// Whether to enable smart acceleration. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`
}

type StandardDebug 

type StandardDebug struct {
	// Whether to enable standard debugging. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable </li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// The client IP to allow. It can be an IPv4/IPv6 address or a CIDR block. If not specified, it means to allow any client IP
	AllowClientIPList []*string `json:"AllowClientIPList,omitnil,omitempty" name:"AllowClientIPList"`

	// The time when the standard debugging setting expires. If it is exceeded, this feature becomes invalid.
	ExpireTime *string `json:"ExpireTime,omitnil,omitempty" name:"ExpireTime"`
}

type SubRule 

type SubRule struct {
	// The condition that determines if a feature should run.
	// Note: If any condition in the array is met, the feature will run.
	Conditions []*RuleAndConditions `json:"Conditions,omitnil,omitempty" name:"Conditions"`

	// The feature to be executed.
	Actions []*Action `json:"Actions,omitnil,omitempty" name:"Actions"`
}

type SubRuleItem 

type SubRuleItem struct {
	// Nested rule settings
	Rules []*SubRule `json:"Rules,omitnil,omitempty" name:"Rules"`

	// Tag of the rule.
	Tags []*string `json:"Tags,omitnil,omitempty" name:"Tags"`
}

type Sv 

type Sv struct {
	// The parameter key.
	Key *string `json:"Key,omitnil,omitempty" name:"Key"`

	// The parameter value.
	Value *string `json:"Value,omitnil,omitempty" name:"Value"`

	// Quota for a resource. Values:
	// <li>`zone`: Quota for sites</li>
	// <li>`custom-rule`: Quota for custom rules</li>
	// <li>`rate-limiting-rule`: Quota for rate limiting rules</li>
	// <li>`l4-proxy-instance`: Quota for L4 proxy instances </li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	Pack *string `json:"Pack,omitnil,omitempty" name:"Pack"`

	// ID of the L4 proxy instance.
	// Note: This field may return null, indicating that no valid values can be obtained.
	InstanceId *string `json:"InstanceId,omitnil,omitempty" name:"InstanceId"`

	// The protection specification.
	// Values: <li> `cm_30G`: 30 Gbps base protection bandwidth in **Chinese mainland** service area</li><li> `cm_60G`: 60 Gbps base protection bandwidth in **Chinese mainland** service area</li><li> `cm_100G`: 100 Gbps base protection bandwidth in **Chinese mainland** service area</li><li> `anycast_300G`: 300 Gbps Anycast-based protection in **Global (MLC)** service area</li><li> `anycast_unlimited`: Unlimited Anycast-based protection bandwidth in **Global (MLC)** service area</li><li> `cm_30G_anycast_300G`: 30 Gbps base protection bandwidth in **Chinese mainland** service area and 300 Gbps Anycast-based protection bandwidth in **Global (MLC)** service area</li><li> `cm_30G_anycast_unlimited`: 30 Gbps base protection bandwidth in **Chinese mainland** service area and unlimited Anycast-based protection bandwidth in **Global (MLC)** service area</li><li> cm_60G_anycast_300G`: 60 Gbps base protection bandwidth in **Chinese mainland** service area and 300 Gbps Anycast-based protection bandwidth in **Global (MLC)** service area</li><li> cm_60G_anycast_unlimited`: 60 Gbps base protection bandwidth in **Chinese mainland** service area and unlimited Anycast-based protection bandwidth in **Global (MLC)** service area</li><li> `cm_100G_anycast_300G`: 100 Gbps base protection bandwidth in **Chinese mainland** service area and 300 Gbps Anycast-based protection bandwidth in **Global (MLC)** service area</li><li> cm_100G_anycast_unlimited`: 100 Gbps base protection bandwidth in **Chinese mainland** service area and unlimited Anycast-based protection bandwidth in **Global (MLC)** service area </li>
	// Note: This field may return null, indicating that no valid values can be obtained.
	ProtectionSpecs *string `json:"ProtectionSpecs,omitnil,omitempty" name:"ProtectionSpecs"`
}

type SwitchConfig 

type SwitchConfig struct {
	// Whether to enable web protection. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>It does not affect DDoS and bot configuration.
	WebSwitch *string `json:"WebSwitch,omitnil,omitempty" name:"WebSwitch"`
}

type Tag 

type Tag struct {
	// The tag key.
	// Note: This field may return null, indicating that no valid values can be obtained.
	TagKey *string `json:"TagKey,omitnil,omitempty" name:"TagKey"`

	// The tag value.
	// Note: This field may return null, indicating that no valid values can be obtained.
	TagValue *string `json:"TagValue,omitnil,omitempty" name:"TagValue"`
}

type Task 

type Task struct {
	// ID of the task.
	JobId *string `json:"JobId,omitnil,omitempty" name:"JobId"`

	// Resource.
	Target *string `json:"Target,omitnil,omitempty" name:"Target"`

	// Type of the task.
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// Node cache purge method, with values:
	// <li>invalidate: Marks as expired. A back-to-origin validation is triggered upon user request, sending an HTTP conditional request with If-None-Match and If-Modified-Since headers. If the origin server responds with 200, the node will fetch new resources from the origin and update the cache; if the origin server responds with 304, the cache will not be updated;</li>
	// <li>delete: Directly deletes the node's cache, triggering a resource fetch from the origin upon user request.</li>
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	Method *string `json:"Method,omitnil,omitempty" name:"Method"`

	// Status. Valid values:
	// <li>processing: Processing;</li>
	// <li>success: Succeeded;</li>
	// <li>failed: Failed;</li>
	// <li>timeout: Timed out. </li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// Creation time of the task.
	CreateTime *string `json:"CreateTime,omitnil,omitempty" name:"CreateTime"`

	// Completion time of the task.
	UpdateTime *string `json:"UpdateTime,omitnil,omitempty" name:"UpdateTime"`
}

type TemplateConfig 

type TemplateConfig struct {
	// The template ID.
	TemplateId *string `json:"TemplateId,omitnil,omitempty" name:"TemplateId"`

	// The template name.
	TemplateName *string `json:"TemplateName,omitnil,omitempty" name:"TemplateName"`
}

type TemplateScope 

type TemplateScope struct {
	// ID of the site.
	// Note: This field may return·null, indicating that no valid values can be obtained.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// List of instance statuses
	// Note: This field may return·null, indicating that no valid values can be obtained.
	EntityStatus []*EntityStatus `json:"EntityStatus,omitnil,omitempty" name:"EntityStatus"`
}

type TimingDataItem 

type TimingDataItem struct {
	// Time point for returning data, in the format of Unix timestamp in seconds.
	Timestamp *int64 `json:"Timestamp,omitnil,omitempty" name:"Timestamp"`

	// The value.
	Value *int64 `json:"Value,omitnil,omitempty" name:"Value"`
}

type TimingDataRecord 

type TimingDataRecord struct {
	// The query dimension value.
	TypeKey *string `json:"TypeKey,omitnil,omitempty" name:"TypeKey"`

	// Detailed time series data
	TypeValue []*TimingTypeValue `json:"TypeValue,omitnil,omitempty" name:"TypeValue"`
}

type TimingTypeValue 

type TimingTypeValue struct {
	// Sum.
	Sum *int64 `json:"Sum,omitnil,omitempty" name:"Sum"`

	// The maximum value.
	Max *int64 `json:"Max,omitnil,omitempty" name:"Max"`

	// The average value.
	Avg *int64 `json:"Avg,omitnil,omitempty" name:"Avg"`

	// Metric name.
	MetricName *string `json:"MetricName,omitnil,omitempty" name:"MetricName"`

	// Details.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Detail []*TimingDataItem `json:"Detail,omitnil,omitempty" name:"Detail"`
}

type TopDataRecord 

type TopDataRecord struct {
	// The query dimension value.
	TypeKey *string `json:"TypeKey,omitnil,omitempty" name:"TypeKey"`

	// Top data rankings
	DetailData []*TopDetailData `json:"DetailData,omitnil,omitempty" name:"DetailData"`
}

type TopDetailData 

type TopDetailData struct {
	// The field name.
	Key *string `json:"Key,omitnil,omitempty" name:"Key"`

	// The field value.
	Value *int64 `json:"Value,omitnil,omitempty" name:"Value"`
}

type TopEntry 

type TopEntry struct {
	// The query dimension value.
	Key *string `json:"Key,omitnil,omitempty" name:"Key"`

	// The details.
	Value []*TopEntryValue `json:"Value,omitnil,omitempty" name:"Value"`
}

type TopEntryValue 

type TopEntryValue struct {
	// The item name.
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// The number of items.
	Count *int64 `json:"Count,omitnil,omitempty" name:"Count"`
}

type UpgradePlanRequest 

type UpgradePlanRequest struct {
	*tchttp.BaseRequest

	// Plan ID, formatted as edgeone-2unuvzjmmn2q.
	PlanId *string `json:"PlanId,omitnil,omitempty" name:"PlanId"`

	// Target plan version for upgrade. Valid values: <li>basic: Basic Edition Plan;</li><li>standard: Standard Edition Plan. </li>
	PlanType *string `json:"PlanType,omitnil,omitempty" name:"PlanType"`

	// Whether to automatically use a voucher. Valid values: <li>true: Yes;</li><li>false: No. </li> If this field is not specified, the default value 'false' will be used.
	AutoUseVoucher *string `json:"AutoUseVoucher,omitnil,omitempty" name:"AutoUseVoucher"`
}

func NewUpgradePlanRequest 

func NewUpgradePlanRequest() (request *UpgradePlanRequest)

func (*UpgradePlanRequest) FromJsonString 

func (r *UpgradePlanRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*UpgradePlanRequest) ToJsonString 

func (r *UpgradePlanRequest) ToJsonString() string

type UpgradePlanRequestParams 

type UpgradePlanRequestParams struct {
	// Plan ID, formatted as edgeone-2unuvzjmmn2q.
	PlanId *string `json:"PlanId,omitnil,omitempty" name:"PlanId"`

	// Target plan version for upgrade. Valid values: <li>basic: Basic Edition Plan;</li><li>standard: Standard Edition Plan. </li>
	PlanType *string `json:"PlanType,omitnil,omitempty" name:"PlanType"`

	// Whether to automatically use a voucher. Valid values: <li>true: Yes;</li><li>false: No. </li> If this field is not specified, the default value 'false' will be used.
	AutoUseVoucher *string `json:"AutoUseVoucher,omitnil,omitempty" name:"AutoUseVoucher"`
}

Predefined struct for user

type UpgradePlanResponse 

type UpgradePlanResponse struct {
	*tchttp.BaseResponse
	Response *UpgradePlanResponseParams `json:"Response"`
}

func NewUpgradePlanResponse 

func NewUpgradePlanResponse() (response *UpgradePlanResponse)

func (*UpgradePlanResponse) FromJsonString 

func (r *UpgradePlanResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*UpgradePlanResponse) ToJsonString 

func (r *UpgradePlanResponse) ToJsonString() string

type UpgradePlanResponseParams 

type UpgradePlanResponseParams struct {
	// Order number.
	DealName *string `json:"DealName,omitnil,omitempty" name:"DealName"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type UpstreamHttp2 

type UpstreamHttp2 struct {
	// Whether to enable HTTP2 origin-pull. Valid values:
	// <li>`on`: Enable;</li>
	// <li>`off`: Disable.</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`
}

type VanityNameServers 

type VanityNameServers struct {
	// Whether to enable custom name servers. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// List of custom name servers
	Servers []*string `json:"Servers,omitnil,omitempty" name:"Servers"`
}

type VanityNameServersIps 

type VanityNameServersIps struct {
	// Custom name of the name server
	Name *string `json:"Name,omitnil,omitempty" name:"Name"`

	// IPv4 address of the custom name server
	IPv4 *string `json:"IPv4,omitnil,omitempty" name:"IPv4"`
}

type VerifyOwnershipRequest 

type VerifyOwnershipRequest struct {
	*tchttp.BaseRequest

	// Site or acceleration domain name
	Domain *string `json:"Domain,omitnil,omitempty" name:"Domain"`
}

func NewVerifyOwnershipRequest 

func NewVerifyOwnershipRequest() (request *VerifyOwnershipRequest)

func (*VerifyOwnershipRequest) FromJsonString 

func (r *VerifyOwnershipRequest) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*VerifyOwnershipRequest) ToJsonString 

func (r *VerifyOwnershipRequest) ToJsonString() string

type VerifyOwnershipRequestParams 

type VerifyOwnershipRequestParams struct {
	// Site or acceleration domain name
	Domain *string `json:"Domain,omitnil,omitempty" name:"Domain"`
}

Predefined struct for user

type VerifyOwnershipResponse 

type VerifyOwnershipResponse struct {
	*tchttp.BaseResponse
	Response *VerifyOwnershipResponseParams `json:"Response"`
}

func NewVerifyOwnershipResponse 

func NewVerifyOwnershipResponse() (response *VerifyOwnershipResponse)

func (*VerifyOwnershipResponse) FromJsonString 

func (r *VerifyOwnershipResponse) FromJsonString(s string) error

FromJsonString It is highly **NOT** recommended to use this function because it has no param check, nor strict type check

func (*VerifyOwnershipResponse) ToJsonString 

func (r *VerifyOwnershipResponse) ToJsonString() string

type VerifyOwnershipResponseParams 

type VerifyOwnershipResponseParams struct {
	// Result of ownership verification
	// <li>`success`: Verification passed</li>
	// <li>`fail`: Verification failed</li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// When the ownership verification result is `fail`, this field returns the reason of failure.
	Result *string `json:"Result,omitnil,omitempty" name:"Result"`

	// The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
	RequestId *string `json:"RequestId,omitnil,omitempty" name:"RequestId"`
}

Predefined struct for user

type Waf 

type Waf struct {
	// Whether to enable WAF. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// ID of the policy
	PolicyId *int64 `json:"PolicyId,omitnil,omitempty" name:"PolicyId"`
}

type WafConfig 

type WafConfig struct {
	// Whether to enable WAF configuration. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>The configuration can be modified even when it is disabled.
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// The protection level. Values:
	// <li>`loose`: Loose</li>
	// <li>`normal`: Moderate</li>
	// <li>`strict`: Strict</li>
	// <li>`stricter`: Super strict</li>
	// <li>`custom`: Custom</li>
	Level *string `json:"Level,omitnil,omitempty" name:"Level"`

	// The WAF global mode. Values:
	// <li>`block`: Block globally</li>
	// <li>`observe`: Observe globally</li>
	Mode *string `json:"Mode,omitnil,omitempty" name:"Mode"`

	// The settings of the managed rule. If it is null, the settings that were last configured will be used.
	WafRule *WafRule `json:"WafRule,omitnil,omitempty" name:"WafRule"`

	// The setting of the AI rule engine. If it is null, the setting that was last configured will be used.
	AiRule *AiRule `json:"AiRule,omitnil,omitempty" name:"AiRule"`
}

type WafRule 

type WafRule struct {
	// Whether to enable managed rules. Values:
	// <li>`on`: Enable</li>
	// <li>`off`: Disable</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// IDs of the rules to be disabled.
	BlockRuleIDs []*int64 `json:"BlockRuleIDs,omitnil,omitempty" name:"BlockRuleIDs"`

	// IDs of the rules to be executed in Observe mode.
	ObserveRuleIDs []*int64 `json:"ObserveRuleIDs,omitnil,omitempty" name:"ObserveRuleIDs"`
}

type WebSocket 

type WebSocket struct {
	// Whether to enable WebSocket connection timeout. Values:
	// <li>`on`: The field "Timeout" can be configured.</li>
	// <li>`off`: The field "Timeout" is fixed to 15 seconds.</li>
	Switch *string `json:"Switch,omitnil,omitempty" name:"Switch"`

	// The timeout period in seconds. Maximum value: 120.
	Timeout *int64 `json:"Timeout,omitnil,omitempty" name:"Timeout"`
}

type Zone 

type Zone struct {
	// Site ID.
	ZoneId *string `json:"ZoneId,omitnil,omitempty" name:"ZoneId"`

	// The site name.
	ZoneName *string `json:"ZoneName,omitnil,omitempty" name:"ZoneName"`

	// List of name servers used by the site
	OriginalNameServers []*string `json:"OriginalNameServers,omitnil,omitempty" name:"OriginalNameServers"`

	// The list of name servers assigned by Tencent Cloud.
	NameServers []*string `json:"NameServers,omitnil,omitempty" name:"NameServers"`

	// The site status. Values:
	// u200c<li>`active`: The name server is switched to EdgeOne.</li>
	// u200c<li>`pending`: The name server is not switched.</li>
	// u200c<li>`moved`: The name server is changed to other service providers.</li>
	// u200c<li>`deactivated`: The site is blocked.</li>
	// <li>`initializing`: The site is not bound with any plan. </li>
	Status *string `json:"Status,omitnil,omitempty" name:"Status"`

	// Site access method. Valid values:
	// <li>full: NS access;</li>
	// <li>partial: CNAME access;</li>
	// <li>noDomainAccess: access with no domain name.</li>
	Type *string `json:"Type,omitnil,omitempty" name:"Type"`

	// Whether the site is disabled.
	Paused *bool `json:"Paused,omitnil,omitempty" name:"Paused"`

	// Whether CNAME acceleration is enabled. Values:
	// <li>`enabled`: Enabled</li>
	// <li>`disabled`: Disabled</li>
	CnameSpeedUp *string `json:"CnameSpeedUp,omitnil,omitempty" name:"CnameSpeedUp"`

	// CNAME record access status. Values:
	// <li>`finished`: The site is verified.</li>
	// <li>`pending`: The site is being verified.</li>
	CnameStatus *string `json:"CnameStatus,omitnil,omitempty" name:"CnameStatus"`

	// The list of resource tags.
	Tags []*Tag `json:"Tags,omitnil,omitempty" name:"Tags"`

	// The list of billable resources.
	Resources []*Resource `json:"Resources,omitnil,omitempty" name:"Resources"`

	// The creation time of the site.
	CreatedOn *string `json:"CreatedOn,omitnil,omitempty" name:"CreatedOn"`

	// The modification date of the site.
	ModifiedOn *string `json:"ModifiedOn,omitnil,omitempty" name:"ModifiedOn"`

	// The site access region. Values:
	// <li>`global`: Global.</li>
	// <li>`mainland`: Chinese mainland.</li>
	// <li>`overseas`: Outside the Chinese mainland.</li>
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// The custom name server information.
	// Note: This field may return null, indicating that no valid values can be obtained.
	VanityNameServers *VanityNameServers `json:"VanityNameServers,omitnil,omitempty" name:"VanityNameServers"`

	// The custom name server IP information.
	// Note: This field may return null, indicating that no valid values can be obtained.
	VanityNameServersIps []*VanityNameServersIps `json:"VanityNameServersIps,omitnil,omitempty" name:"VanityNameServersIps"`

	// Status of the proxy. Values:
	// <li>`active`: Enabled</li>
	// <li>`inactive`: Not activated</li>
	// <li>`paused`: Disabled</li>
	ActiveStatus *string `json:"ActiveStatus,omitnil,omitempty" name:"ActiveStatus"`

	// The site alias. It can be up to 20 characters consisting of digits, letters, hyphens (-) and underscores (_).
	// Note: This field may return null, indicating that no valid values can be obtained.
	AliasZoneName *string `json:"AliasZoneName,omitnil,omitempty" name:"AliasZoneName"`

	// Whether it’s a fake site. Valid values:
	// <li>`0`: Non-fake site;</li>
	// <li>`1`: Fake site.</li>
	IsFake *int64 `json:"IsFake,omitnil,omitempty" name:"IsFake"`

	// Lock status. Values: <li>`enable`: Normal. Modification is allowed.</li><li>`disable`: Locked. Modification is not allowed.</li><li>`plan_migrate`: Adjusting the plan. Modification is not allowed.</li>
	LockStatus *string `json:"LockStatus,omitnil,omitempty" name:"LockStatus"`

	// Ownership verification information
	// Note: This field may return·null, indicating that no valid values can be obtained.
	OwnershipVerification *OwnershipVerification `json:"OwnershipVerification,omitnil,omitempty" name:"OwnershipVerification"`
}

type ZoneSetting 

type ZoneSetting struct {
	// Name of the site
	ZoneName *string `json:"ZoneName,omitnil,omitempty" name:"ZoneName"`

	// Site acceleration region. Values:
	// <li>`mainland`: Acceleration in the Chinese mainland.</li>
	// <li>`overseas`: Acceleration outside the Chinese mainland.</li>
	Area *string `json:"Area,omitnil,omitempty" name:"Area"`

	// Node cache key configuration
	// Note: This field may return null, indicating that no valid values can be obtained.
	CacheKey *CacheKey `json:"CacheKey,omitnil,omitempty" name:"CacheKey"`

	// The QUIC access configuration.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Quic *Quic `json:"Quic,omitnil,omitempty" name:"Quic"`

	// The POST transport configuration.
	// Note: This field may return null, indicating that no valid values can be obtained.
	PostMaxSize *PostMaxSize `json:"PostMaxSize,omitnil,omitempty" name:"PostMaxSize"`

	// Smart compression configuration.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Compression *Compression `json:"Compression,omitnil,omitempty" name:"Compression"`

	// HTTP2 origin-pull configuration
	// Note: This field may return null, indicating that no valid values can be obtained.
	UpstreamHttp2 *UpstreamHttp2 `json:"UpstreamHttp2,omitnil,omitempty" name:"UpstreamHttp2"`

	// Force HTTPS redirect configuration
	// Note: This field may return null, indicating that no valid values can be obtained.
	ForceRedirect *ForceRedirect `json:"ForceRedirect,omitnil,omitempty" name:"ForceRedirect"`

	// Cache expiration time configuration
	// Note: This field may return null, indicating that no valid values can be obtained.
	CacheConfig *CacheConfig `json:"CacheConfig,omitnil,omitempty" name:"CacheConfig"`

	// Origin server configuration.
	// Note: This field may return null, indicating that no valid values can be obtained.
	Origin *Origin `json:"Origin,omitnil,omitempty" name:"Origin"`

	// Smart acceleration configuration
	// Note: This field may return null, indicating that no valid values can be obtained.
	SmartRouting *SmartRouting `json:"SmartRouting,omitnil,omitempty" name:"SmartRouting"`

	// Browser cache configuration
	// Note: This field may return null, indicating that no valid values can be obtained.
	MaxAge *MaxAge `json:"MaxAge,omitnil,omitempty" name:"MaxAge"`

	// The offline cache configuration.
	// Note: This field may return null, indicating that no valid values can be obtained.
	OfflineCache *OfflineCache `json:"OfflineCache,omitnil,omitempty" name:"OfflineCache"`

	// WebSocket configuration.
	// Note: This field may return null, indicating that no valid values can be obtained.
	WebSocket *WebSocket `json:"WebSocket,omitnil,omitempty" name:"WebSocket"`

	// Origin-pull client IP header configuration
	// Note: This field may return null, indicating that no valid values can be obtained.
	ClientIpHeader *ClientIpHeader `json:"ClientIpHeader,omitnil,omitempty" name:"ClientIpHeader"`

	// Cache prefresh configuration
	// Note: This field may return null, indicating that no valid values can be obtained.
	CachePrefresh *CachePrefresh `json:"CachePrefresh,omitnil,omitempty" name:"CachePrefresh"`

	// IPv6 access configuration
	// Note: This field may return null, indicating that no valid values can be obtained.
	Ipv6 *Ipv6 `json:"Ipv6,omitnil,omitempty" name:"Ipv6"`

	// HTTPS acceleration configuration
	// Note: This field may return null, indicating that no valid values can be obtained.
	Https *Https `json:"Https,omitnil,omitempty" name:"Https"`

	// Whether to carry the location information of the client IP during origin-pull.
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	ClientIpCountry *ClientIpCountry `json:"ClientIpCountry,omitnil,omitempty" name:"ClientIpCountry"`

	// Configuration of gRPC support
	// Note: This field may return `null`, indicating that no valid value can be obtained.
	Grpc *Grpc `json:"Grpc,omitnil,omitempty" name:"Grpc"`

	// Image optimization configuration.
	// Note: This field may return `null`, indicating that no valid value was found.
	ImageOptimize *ImageOptimize `json:"ImageOptimize,omitnil,omitempty" name:"ImageOptimize"`

	// Cross-MLC-border acceleration.
	// Note: This field may return `null`, indicating that no valid values can be obtained.
	AccelerateMainland *AccelerateMainland `json:"AccelerateMainland,omitnil,omitempty" name:"AccelerateMainland"`

	// Standard debugging configuration.
	// Note: This field may return null, indicating that no valid values can be obtained.
	StandardDebug *StandardDebug `json:"StandardDebug,omitnil,omitempty" name:"StandardDebug"`

	// Just-in-time media processing configuration.
	// Note: This field may return null, which indicates a failure to obtain a valid value.
	JITVideoProcess *JITVideoProcess `json:"JITVideoProcess,omitnil,omitempty" name:"JITVideoProcess"`
}

Source Files

View all Source files

Jump to

Keyboard shortcuts

? : This menu
/ : Search site
f or F : Jump to
y or Y : Canonical URL
go.dev uses cookies from Google to deliver and enhance the quality of its services and to analyze traffic. Learn more.